KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0325Help
Entry
Glaag_0325        CDS       T01483                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_0325
   01230 Biosynthesis of amino acids
    Glaag_0325
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glaag_0325
   00290 Valine, leucine and isoleucine biosynthesis
    Glaag_0325
Enzymes [BR:gag01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     Glaag_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362515..363531
Genome map
AA seq 338 aa AA seqDB search
MPEVTFADISAARQRIANYVRTSELMTSALLNHWLGHEVLFKTECLQRTGAFKLRGALNT
LLHARQQKQSIKRVVASSSGNHAQAVAYAASLFNIPVTIFSAQNISKIKAAATRSYGAEL
RLFPLRDDADIAVEQAAQEPGTLWIPPFNHPDVIAGQGTVAAEIFEQTSDVNAIFMPCGG
GGLASGSLIAARHNSPQSNVIACEPLAGNDAAQSLRLGSIQRLTTPAKTLADGAATPAVG
EHTYPIIQQLDGFYEVDERQIAYWTQWLQHLLKLHIEPTSAMSMHGVVNYLAQQNSPQKV
VVILSGGNIDAQKMQQIWQDDHLIHQPSLPNAPLASVI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagtgacttttgcagatatcagcgcggcaagacaacgtattgctaactacgtg
cgtacgtctgagctcatgacgtctgcgttactgaatcattggctagggcacgaagtgcta
tttaaaacagaatgtctgcaacgtacaggcgcatttaagttacggggtgcgttgaataca
ctgttgcatgcaaggcagcaaaagcaatccattaagcgagtagtggcaagtagttctggt
aatcacgcccaggcagtagcctatgcagcttctttgtttaatattccagtgaccattttt
agcgcgcaaaacatttcgaaaattaaagctgccgctacccgctcttacggggctgagtta
cgtttgtttccgttacgagatgacgccgacattgccgtagagcaagcagcccaagagccg
ggtacgttatggatcccgccttttaatcatcctgatgttatcgcggggcagggcacggta
gctgctgaaatattcgagcaaacttcagatgtcaatgcgatattcatgccttgtggcggc
gggggattagcctcgggtagcttgattgcagcaagacacaatagcccgcaatctaacgtg
attgcctgtgaaccattggctggcaatgacgcagcgcaatcattgcgtttaggcagcata
cagcgtttaactacgccggctaaaacccttgccgatggggcggcaacgcctgcagttggc
gagcatacatatccgattattcagcaattggacggtttttatgaggtggacgaaaggcaa
atcgcctactggacccagtggttacagcatttgttgaaacttcatatcgagccaacgagc
gcgatgagtatgcatggtgtagtgaattatctagcgcaacaaaactcgccgcaaaaagtg
gtggtgattttatctggcgggaatatcgatgcgcagaaaatgcagcagatatggcaagat
gatcatttaattcatcagccaagcttaccgaacgcgccgttagcgtctgtgatttag

DBGET integrated database retrieval system