KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0325Help
Entry
Glaag_0325        CDS       T01483                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; Carbon metabolism [PATH:gag01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gag01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gag00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:gag00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362515..363531
Genome map
AA seq 338 aa AA seqDB search
MPEVTFADISAARQRIANYVRTSELMTSALLNHWLGHEVLFKTECLQRTGAFKLRGALNT
LLHARQQKQSIKRVVASSSGNHAQAVAYAASLFNIPVTIFSAQNISKIKAAATRSYGAEL
RLFPLRDDADIAVEQAAQEPGTLWIPPFNHPDVIAGQGTVAAEIFEQTSDVNAIFMPCGG
GGLASGSLIAARHNSPQSNVIACEPLAGNDAAQSLRLGSIQRLTTPAKTLADGAATPAVG
EHTYPIIQQLDGFYEVDERQIAYWTQWLQHLLKLHIEPTSAMSMHGVVNYLAQQNSPQKV
VVILSGGNIDAQKMQQIWQDDHLIHQPSLPNAPLASVI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagtgacttttgcagatatcagcgcggcaagacaacgtattgctaactacgtg
cgtacgtctgagctcatgacgtctgcgttactgaatcattggctagggcacgaagtgcta
tttaaaacagaatgtctgcaacgtacaggcgcatttaagttacggggtgcgttgaataca
ctgttgcatgcaaggcagcaaaagcaatccattaagcgagtagtggcaagtagttctggt
aatcacgcccaggcagtagcctatgcagcttctttgtttaatattccagtgaccattttt
agcgcgcaaaacatttcgaaaattaaagctgccgctacccgctcttacggggctgagtta
cgtttgtttccgttacgagatgacgccgacattgccgtagagcaagcagcccaagagccg
ggtacgttatggatcccgccttttaatcatcctgatgttatcgcggggcagggcacggta
gctgctgaaatattcgagcaaacttcagatgtcaatgcgatattcatgccttgtggcggc
gggggattagcctcgggtagcttgattgcagcaagacacaatagcccgcaatctaacgtg
attgcctgtgaaccattggctggcaatgacgcagcgcaatcattgcgtttaggcagcata
cagcgtttaactacgccggctaaaacccttgccgatggggcggcaacgcctgcagttggc
gagcatacatatccgattattcagcaattggacggtttttatgaggtggacgaaaggcaa
atcgcctactggacccagtggttacagcatttgttgaaacttcatatcgagccaacgagc
gcgatgagtatgcatggtgtagtgaattatctagcgcaacaaaactcgccgcaaaaagtg
gtggtgattttatctggcgggaatatcgatgcgcagaaaatgcagcagatatggcaagat
gatcatttaattcatcagccaagcttaccgaacgcgccgttagcgtctgtgatttag

DBGET integrated database retrieval system