KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0325Help
Entry
Glaag_0325        CDS       T01483                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00260  Glycine, serine and threonine metabolism
gag00290  Valine, leucine and isoleucine biosynthesis
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
gag01230  Biosynthesis of amino acids
Module
gag_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glaag_0325
   00290 Valine, leucine and isoleucine biosynthesis
    Glaag_0325
Enzymes [BR:gag01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     Glaag_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEE21294
UniProt: F4AIM4
Position
362515..363531
Genome map
AA seq 338 aa AA seqDB search
MPEVTFADISAARQRIANYVRTSELMTSALLNHWLGHEVLFKTECLQRTGAFKLRGALNT
LLHARQQKQSIKRVVASSSGNHAQAVAYAASLFNIPVTIFSAQNISKIKAAATRSYGAEL
RLFPLRDDADIAVEQAAQEPGTLWIPPFNHPDVIAGQGTVAAEIFEQTSDVNAIFMPCGG
GGLASGSLIAARHNSPQSNVIACEPLAGNDAAQSLRLGSIQRLTTPAKTLADGAATPAVG
EHTYPIIQQLDGFYEVDERQIAYWTQWLQHLLKLHIEPTSAMSMHGVVNYLAQQNSPQKV
VVILSGGNIDAQKMQQIWQDDHLIHQPSLPNAPLASVI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagtgacttttgcagatatcagcgcggcaagacaacgtattgctaactacgtg
cgtacgtctgagctcatgacgtctgcgttactgaatcattggctagggcacgaagtgcta
tttaaaacagaatgtctgcaacgtacaggcgcatttaagttacggggtgcgttgaataca
ctgttgcatgcaaggcagcaaaagcaatccattaagcgagtagtggcaagtagttctggt
aatcacgcccaggcagtagcctatgcagcttctttgtttaatattccagtgaccattttt
agcgcgcaaaacatttcgaaaattaaagctgccgctacccgctcttacggggctgagtta
cgtttgtttccgttacgagatgacgccgacattgccgtagagcaagcagcccaagagccg
ggtacgttatggatcccgccttttaatcatcctgatgttatcgcggggcagggcacggta
gctgctgaaatattcgagcaaacttcagatgtcaatgcgatattcatgccttgtggcggc
gggggattagcctcgggtagcttgattgcagcaagacacaatagcccgcaatctaacgtg
attgcctgtgaaccattggctggcaatgacgcagcgcaatcattgcgtttaggcagcata
cagcgtttaactacgccggctaaaacccttgccgatggggcggcaacgcctgcagttggc
gagcatacatatccgattattcagcaattggacggtttttatgaggtggacgaaaggcaa
atcgcctactggacccagtggttacagcatttgttgaaacttcatatcgagccaacgagc
gcgatgagtatgcatggtgtagtgaattatctagcgcaacaaaactcgccgcaaaaagtg
gtggtgattttatctggcgggaatatcgatgcgcagaaaatgcagcagatatggcaagat
gatcatttaattcatcagccaagcttaccgaacgcgccgttagcgtctgtgatttag

DBGET integrated database retrieval system