KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0403Help
Entry
Glaag_0403        CDS       T01483                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450336..450893
Genome map
AA seq 185 aa AA seqDB search
MNEQLKASYEQILSNLGEDVNRPGLKDTPARAAKAMQYLCDGYNMTIEEIVNGALFPSDT
DEMVIVNNIELYSLCEHHMLPFIGKAHVAYLPTGNVIGLSKIARIVDMFARRLQIQENIT
LEIAQAIQSVTNAAGVGVVIEAKHMCMMMRGVEKQNSAMISSVMLGEFRDSSRTRQEFLQ
LIGRN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaactaaaagcatcgtatgaacaaattttaagtaatttgggggaagatgta
aatcgacctgggttgaaagacacgcctgcccgagcagcaaaagcgatgcagtatttgtgt
gatggatacaatatgacgattgaagaaatcgtaaacggtgcgctatttccatcagacact
gatgaaatggtgattgttaataatatagaattgtactctttatgtgaacaccacatgtta
ccttttatcggtaaagcacacgtggcgtacttgcctacaggcaatgtaattgggctttca
aaaattgctcgtatagtcgatatgtttgcacgtcgtttacaaattcaagaaaacattacc
ttggaaattgcccaagctattcaaagtgtaaccaatgccgctggtgtgggagttgttatt
gaggctaaacacatgtgcatgatgatgcgtggagtagaaaaacaaaactcagcaatgatt
tcatccgttatgctaggggaatttcgtgattctagcaggactcgtcaggagttcttacag
ttgatagggcgtaattaa

DBGET integrated database retrieval system