KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0438Help
Entry
Glaag_0438        CDS       T01483                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gag00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486063..486710
Genome map
AA seq 215 aa AA seqDB search
MPQSLGNLFILAAPSGAGKSSLIKALLQNHDATEIHNNEMQVSVSHTTRAPRPGEIDGVH
YHFVSREVFQELISQDEFFEWAEVFGNYYGTSKVVIEQTLRKGIDVFLDIDWQGARQVKA
QIPDTATIFVAPPSRDELLRRLTERGQDTPEVIQERMNKAVSEISHYHEFDYIVVNDDFD
AALAELDAIVSSRRLRKEKQVMRHQSLFENLLAND
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatcactcggaaatttatttatacttgccgcgccttctggagctggtaaatct
agcttaatcaaagcgttactgcaaaaccatgacgcaacagaaatacacaacaatgaaatg
caggtctcggtttctcataccactagagcaccgcgcccaggtgaaatagacggtgtacat
tatcattttgttagtcgagaggtatttcaagagctcatttcccaagatgaattttttgaa
tgggctgaagtcttcggtaattattacggcacctctaaagtagtgattgaacaaacattg
cgcaaagggattgacgtatttttagatatcgactggcagggggctcgtcaggtaaaagcg
caaatcccggatactgcaacgatttttgttgcgccgccctcacgtgacgagcttttgcgt
cgtttaaccgagcgcggacaagacactcctgaggtgatccaagagcgaatgaataaagcg
gtatctgaaatatcgcactatcatgaattcgattatatcgtggtgaatgatgattttgac
gcggcgctagcagagctagatgcgattgtatcaagccgtcgtttgcgcaaagaaaagcag
gtaatgcgtcatcaaagcctgtttgaaaacttactggccaatgattag

DBGET integrated database retrieval system