KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0536Help
Entry
Glaag_0536        CDS       T01483                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Glaag_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(596598..597617)
Genome map
AA seq 339 aa AA seqDB search
MKNHDLENSFKHLKNTIPLLLKHKIPAVPLNYALWYTYASKESESLNETLDDALQRNLPI
SDSKTKDLYRKHVADEQDIDTWDLRHSLESMVIELSQSVQDTRSETRNFKSTMDTCMDDL
AKVEREGLSMEEVMDLVRTLVNQTKQIRGSTLSFSSALNDAEKEISRLRSQLEQSQQAAL
YDALTGLCNRRYFDEELAAHAMRPHMCLILVDLDNFKTINDTHGHVMGDLVLKACAKKLQ
VACREGAQAFRFGGEEFAIIVPNCKLNVARQIAETMRRAIEKIGVKDKRTSEVLGGISAS
FGVAEMKQGMNPLGLIQAADKHLYDAKNLGRNRVMPISN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatcacgatttagaaaattcatttaagcatcttaaaaataccattccattgttg
cttaagcacaaaattcccgctgtgccgctaaactatgctttatggtatacatacgccagt
aaagaatctgaatctctaaatgaaacgctggatgatgcgttgcaacgtaatttgcccata
tcagactcaaaaaccaaagatttgtatcgaaaacatgtcgccgatgaacaggatatagat
acatgggatcttcgccattctcttgaaagcatggtcattgaactgtcccaatcagtacaa
gatacccgcagtgaaacccgcaacttcaaaagtaccatggatacctgcatggacgattta
gccaaagttgagcgtgaagggttaagcatggaagaagtgatggatctggtccgcacactc
gttaaccaaacaaaacaaattcgtggcagcaccttatcttttagcagtgcgctaaacgat
gcagaaaaagaaatctcccgtttgagaagtcaactagaacaaagtcaacaagccgccctg
tacgacgcgctaacgggcctatgcaatcgcagatattttgacgaagagctagctgcccat
gccatgcgaccacacatgtgtttaatattagtcgacctcgataactttaaaaccatcaac
gacactcacggccacgtcatgggcgatttagtattaaaggcctgcgctaaaaagcttcag
gtcgcttgtcgtgaaggagctcaggcgttccgttttggtggcgaggaattcgcgatcatc
gtacccaattgcaagctaaatgtagcacggcaaatcgccgaaactatgcgccgagcgatc
gaaaaaataggtgttaaagacaagcgcacgtccgaggtactcggtggtatcagcgcttct
tttggcgttgcagaaatgaagcaaggcatgaacccattaggacttattcaagcagctgat
aaacatttatatgatgcgaagaatttagggcgtaatcgcgttatgcctatttcaaattaa

DBGET integrated database retrieval system