KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0597Help
Entry
Glaag_0597        CDS       T01483                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_0597
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_0597
   00620 Pyruvate metabolism
    Glaag_0597
   00640 Propanoate metabolism
    Glaag_0597
  Energy metabolism
   00680 Methane metabolism
    Glaag_0597
Enzymes [BR:gag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Glaag_0597
Lipid biosynthesis proteins [BR:gag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Glaag_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681810..683750
Genome map
AA seq 646 aa AA seqDB search
MSQQIYPVPARAKEQSHLTPQDYARMYAKSVEDPETFWAEQAKSLDWVTAPTKIKNTSFD
AHNVSIKWFEDGELNVTYNCIDRHLATRGHVTAFIWEGDDPHSHDIITYHRLHDEVAKIA
NGLRKLGVGKGDRVAIYMPMIPQAVYAMLACARIGAVHTVIFGGFSPNAIADRVNNCQAK
VLMTADEGLRAGKQIPLKANVDSALAEHDCPSMEHVVVYKHTGNDVDWGKNDVCWDELTA
QCSTDCPPEVMNAEDPLFILYTSGSTGQPKGVVHTTGGYLLWASITHKYVFDYKPGDIYW
CAADVGWVTGHSYIVYGPLANGATSVMFEGVPTYPDVRRIGQIVDKHKVNILYTAPTAIR
ALMAHGDFPVEGISGESLRLLGSVGEPINPEAWHWYYTTVGQSRCPVVDTWWQTETGGAM
ITPLPSVTAMKPGAASHPFFGVQPALVDGQGNELHGATDGNLIITDSWPGQARTVYGDHE
RFVQTYFTTYPGTYCTGDGARRDEDDYFWITGRVDDVLNVSGHRLGTAEIESALVSHHAV
AEAAVVGYPHDLKGQGIYVYIMANEGVEVNEELTKEVSNWVRKELSPIATPDLIQWSSGL
PKTRSGKIMRRILRKIAANEYEQLGDTSTLADPGVVDTLIEQRLNR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacaaatttatcctgttccagcacgcgctaaagagcaaagccaccttacacca
caagactatgcacgcatgtatgcaaagtcagtggaagatcccgaaacattttgggcagag
caagcgaagtccctagattgggtaactgcaccgactaaaattaaaaacacctcatttgac
gcccataatgtcagcattaagtggttcgaagatggtgagttaaacgtgacgtacaattgc
attgaccgtcacctggcaacacgcggccatgtaacggcgtttatatgggaaggcgatgac
ccgcattctcatgacattatcacttaccaccgcttgcatgatgaagtcgctaaaatagcc
aacggtttacgcaaactaggtgttggcaaaggtgatcgtgtagcgatttatatgccgatg
atccctcaagctgtttacgccatgttagcttgcgccagaattggcgcagtgcacactgtg
atatttggtggcttttcacctaatgcgattgccgatcgggtgaacaattgccaagcaaaa
gtgttgatgaccgctgatgaagggttaagagcaggcaagcagatccccttaaaagcgaat
gttgatagtgcattggctgaacacgattgcccgagtatggaacatgtcgtggtgtataaa
catacaggcaatgatgtcgactggggtaaaaacgatgtttgctgggatgagctgacagca
cagtgcagcactgattgcccgccagaggtaatgaacgctgaagacccgctctttattttg
tatacctctggctcaacaggtcaaccgaaaggggttgtgcatactacaggtggctacctg
ctatgggcgtcaatcacccacaaatacgtatttgattacaagcctggggatatttactgg
tgtgcagcggatgttggttgggtcacaggacatagttatatcgtttatggaccccttgcc
aatggcgcaacgagcgttatgtttgaaggcgtaccaacttacccagacgtgcgccgcatt
gggcaaatagttgataagcataaggtcaatattttgtataccgcgcctaccgctattcga
gcattaatggcccacggagatttcccagtcgaaggaataagcggcgaatctttgcgtttg
ctaggatctgttggggagccgattaatcctgaagcgtggcattggtattacaccacagtt
ggtcagtctcgttgtccggttgtggatacatggtggcaaacggaaactggcggcgcgatg
ataacgccattgcctagtgttacggcaatgaagccaggcgcagctagtcatccgtttttt
ggtgtacaacccgcccttgttgacggacaaggcaatgaattacacggtgccactgacgga
aacttgattattactgacagctggccgggacaagcgcgcaccgtttatggtgatcatgag
cgctttgtacaaacctattttaccacctacccaggcacctactgcaccggtgatggcgcg
cgccgtgatgaagatgattatttctggatcacaggccgtgtagatgacgtactgaatgtt
tctggtcatcgcttaggcacagctgaaattgaaagcgcgttagtttctcatcacgctgtt
gctgaggcagcggtggtgggttatccccatgaccttaaaggccagggtatttatgtttat
atcatggccaatgaaggtgttgaggtaaatgaagagctgactaaagaggtgtctaattgg
gtacgtaaagaacttagtccaattgctacgcctgatttgatacaatggtcgtctggttta
cctaagactcgctcaggtaaaattatgcgtcgtatcttacgtaagatcgccgcaaatgaa
tatgagcaactcggtgatacatcaacgctagctgatcccggtgtagtagacacactgatt
gagcagcgcttgaatcgctaa

DBGET integrated database retrieval system