KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0625Help
Entry
Glaag_0625        CDS       T01483                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Glaag_0625
Enzymes [BR:gag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Glaag_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
716139..716693
Genome map
AA seq 184 aa AA seqDB search
MSEDLTQHYSQILSILGEDTQRGGLVDTPKRAAKAMQFLTDGYEKNLDDVVNGAIFEADT
DEMVVIQNIEYYSLCEHHILPFIGQCHIAYLPKGKVLGLSKFARIVDMYARRLQIQEGLT
KQIADAIQEVTGAAGVGVIMEGKHMCMMMRGVQKQNSSMVTSVMLGGMRNSDATRNEFLR
LIGK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagatttaacccagcattactcgcaaattctatcgattttaggtgaggatacc
cagcgaggtggattagtagatacgcctaagcgcgcagcaaaagcgatgcagtttttaacc
gatggttatgaaaagaaccttgatgacgtggttaacggcgcgatttttgaagccgacacg
gatgaaatggttgttattcagaacattgaatattactcattgtgtgaacaccatatctta
ccctttattggtcagtgtcatattgcatacttacctaagggcaaagtacttggtttatct
aagtttgctcgtatcgtggatatgtacgcgcgccgcttacaaattcaggaagggttaact
aagcaaatagccgatgcaattcaagaagtaactggtgctgctggcgttggtgtgattatg
gaaggtaagcacatgtgcatgatgatgcgcggtgtgcaaaagcagaactcttcaatggtt
acttctgtgatgttaggtggaatgcgtaactctgacgccactcgcaatgagtttttgcgt
ctaatcggtaagtaa

DBGET integrated database retrieval system