KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0831Help
Entry
Glaag_0831        CDS       T01483                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Glaag_0831
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Glaag_0831
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(973954..975447)
Genome map
AA seq 497 aa AA seqDB search
MRIKDCILAIDQGTTSTRAIIFAPDSSIIAVAQQEFAQHYPNDGWVEHDPEDIWSSTVVV
CRQAISEAIAKGARIAAIGVTNQRETTVVWDRNTGQAIYNAIVWQDRRTAQTCRDMQDKG
LFDVVNSRTGLLLDPYFSASKVAWILDNVDGAREKAEAGDLAFGTIDSFLIWRLTDGQMH
ATDVTNASRTNLFNIHDMAWDPKLLEVFNVPKSVLPEVKECADDFGHTTEDLFGFSLPIL
GVAGDQQAASIGQCCFNEGAIKSTYGTGCFVMLNTGTKAFNSKNKLLTTVAYTINGETHY
ALEGSIFIAGAAIQWLRDGLGVIRSASETEALAKSLDDDHGVYMVPAFAGLGAPHWAPNA
RGAVFGLTRGTTNAHFVRAALESVCYQTSDLLHAMAEDGVSLDKIRVDGGMVGNNWLCQF
LAGILDVTVERPKIMETTALGAAYLAGLKAGIYQSCEQLASMNEVESSFEASMASSQRRK
LISGWENAVQSTLGYSK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaaagattgtatattagctattgaccaaggtaccacttcaacgcgagccatc
atttttgcgcctgattcgagcattattgcagtagctcaacaagagttcgctcaacattac
ccgaatgatggttgggtagagcacgaccctgaggatatctggtcttctactgtggttgtg
tgccgccaagcgatatcagaagcgattgcaaaaggcgcgcgtattgctgccattggggtt
acgaaccaacgtgaaaccaccgttgtttgggacagaaacacagggcaagctatttataat
gccattgtttggcaggacagacgcactgcgcaaacttgtcgagatatgcaagataaaggt
ttgttcgacgtggtgaattcccgcacagggttattactcgacccttatttttctgcctca
aaagtcgcttggatcctagataatgttgacggggcacgtgagaaggccgaagctggcgat
ctggcatttggtaccatagattccttccttatttggcgtttaactgacgggcaaatgcat
gccacagacgtgaccaatgcaagtaggaccaatttgttcaatatccatgatatggcgtgg
gatcctaagctattagaagtgtttaatgtgcctaaatctgtgctacctgaagttaaggag
tgtgccgatgattttggtcacacaacggaagacttgtttggtttttccttaccaatattg
ggtgtggcaggcgatcaacaagccgccagtataggccaatgctgtttcaatgaaggcgca
atcaaaagcacctatggtactggctgctttgttatgctcaacacgggtactaaagcgttt
aattcaaaaaacaagttgttgactacagtagcctacaccattaacggtgagactcactat
gcgctagaaggctcaatctttattgcaggtgcagccattcagtggttacgcgatggatta
ggtgtaataagaagtgcttcagaaaccgaagcgttagccaaatctttggatgacgatcac
ggcgtatatatggtgcctgcctttgcaggattaggcgcacctcattgggcaccaaacgcc
cgtggcgctgtgttcggcctaactcgtggcactaccaatgctcatttcgttcgggcagcg
cttgaatcagtgtgctatcaaacatctgacttacttcacgctatggccgaagacggcgta
tccttggataaaattcgcgtagatggcggtatggtgggcaataactggttatgtcagttc
ctagcaggcattctcgatgtcaccgtagagcgccccaaaataatggaaactaccgcccta
ggcgctgcataccttgcagggcttaaagcgggtatctatcaatcatgcgagcagttggcg
agtatgaacgaggtagaaagcagttttgaagcgagcatggcgtcatcgcaacgcagaaag
cttatttcaggctgggaaaatgcagtacaaagcacgttagggtattcaaaatga

DBGET integrated database retrieval system