KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0859Help
Entry
Glaag_0859        CDS       T01483                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Glaag_0859
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Glaag_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1005738..1006634)
Genome map
AA seq 298 aa AA seqDB search
MAVINFGSINVDHVYQVDHFVQPGETLASTNYQCLLGGKGANQSIALAKAGADVRHVGRI
NESDANFKQVMIKHNINCKYVACTESPSGHAIIQVTPTGENAIVLFGGANHEISPKDVMA
ALDGAKSSDWVLTQNETSSIDEVLKQAKEAGLKVAFNPAPMTDSVKQLPVDCIDLLIVNE
VEAEEISGHKDIDAMEKYFHANWPNCEIIITLGKAGVCMLKNERRIEVDAFVVDAVDTTA
AGDTFIGFFLSAYSEHTDAKTALTRACAASALAVTQVGAAQSIPDEEQVNRFLAKHHS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcagttattaactttggttctattaatgtggaccatgtttatcaggtagatcacttt
gtgcagcctggtgaaaccctagcctcaacaaattatcagtgtttacttggcggaaaaggt
gcgaatcaatctatcgcccttgcgaaagctggcgctgatgtacgtcatgtggggcgtatc
aacgagtccgatgcgaacttcaagcaagtcatgattaagcacaatatcaactgtaagtat
gtggcatgcactgaaagcccatctggccatgccattattcaagtcactcccaccggcgaa
aacgcaattgtactgttcggcggcgcaaatcatgaaatatcacctaaagatgtgatggcg
gcgcttgatggcgcaaaatcgagcgactgggtgttaactcaaaacgaaaccagttctatc
gatgaagtcctcaagcaagcaaaagaagccggtttgaaagtagccttcaatcctgcgcca
atgaccgattcagttaaacaattaccggtagactgtatcgatttattgatcgtcaacgaa
gttgaagcagaagaaatttctggtcacaaagatatcgatgccatggaaaaatatttccat
gcaaactggcctaattgtgaaattattattactttaggtaaagcaggtgtttgtatgctc
aagaatgagcgcagaattgaagtggatgcttttgtagttgatgcggtagacacaacagcc
gcaggtgacaccttcattggtttcttcctatccgcgtacagtgaacacactgacgcaaaa
actgcactcacccgagcgtgtgctgcatcggccttagctgttacccaagtgggagcggca
caatcgattccggatgaagagcaagttaatcgctttcttgctaaacatcatagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system