KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1302Help
Entry
Glaag_1302        CDS       T01483                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Glaag_1302
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Glaag_1302
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Glaag_1302
Two-component system [BR:gag02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Glaag_1302
Bacterial motility proteins [BR:gag02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Glaag_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1515025..1516176
Genome map
AA seq 383 aa AA seqDB search
MAYKILVVDDSIFFRRRVKEILELDPNLEVIGEARNGQEAIDMVASLNPDVVTMDVEMPV
MDGITAVKKIMARKPVPIIMFSSLTLEGAKATLDALDAGAMDFLPKKFEDIAANRADAVA
LLQSRVKGLCRKHHGLRPAAPRVTAPKAILFNKPVSRSALGRKGSEQTTRSAAGIVTTPL
YQSSSSDIPSGKKYRCLALGTSTGGPVALQKVLTTMPKHFPYPIFIVQHMPGSFTKAFAE
RLNQLSKLTVKEAVNGEVVQAGVAYLAPGGRQMTIQGDAERATFRIYDAPVSADILYKPS
VDITFESIANVYRGDVLGIILTGMGTDGKIGASTLKRNGAKIWAQDELSSVVYGMPQAVM
NSGIAEKEFSIDSFESHIVKEMA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaagatattagtagttgatgattcgattttttttaggcgccgtgtaaaagaa
attttagagctagatcccaatttagaggttataggtgaggcacgaaacggccaagaagca
attgatatggtcgcctccttgaacccagatgtggtgactatggacgtagaaatgcctgtg
atggacggaataacggcagtcaaaaaaatcatggcgcgtaaacctgttcctatcattatg
ttttcttctttgacccttgaaggtgcgaaagccacgcttgacgcattagacgcaggggcg
atggactttttaccaaagaaatttgaagatattgcggctaaccgtgcggatgctgtcgcg
ctattacagtcaagagtgaaaggcctatgccgaaaacaccacggtctcagaccagcagct
ccccgagtaacggctccaaaagcgattttattcaataaacctgttagtcgaagtgcgcta
ggtcgaaaaggcagtgagcaaacaactcggtctgctgctggtatcgtcacaacgccccta
tatcaatcttcgtctagcgacataccatcgggcaaaaagtatcgctgtttagcccttggc
acgtctactggcggaccggtcgctttacaaaaagtgctaaccactatgccgaagcatttt
ccgtatccgatatttattgtgcaacatatgcctggttctttcaccaaagccttcgcagaa
cgtttaaatcagttatcgaagctaacggtcaaagaggctgtaaatggcgaggttgtgcaa
gctggcgttgcttacttggctccaggcggacggcaaatgacaatccagggcgatgccgaa
cgagcaacatttagaatttatgatgcaccagttagtgccgatatattatacaaacccagt
gttgatattaccttcgagtcaattgctaatgtatatcgtggggatgttctaggcattatt
ttaaccggcatgggaactgacggaaaaatcggcgcaagtacactgaaaagaaatggcgca
aaaatttgggctcaagatgagctaagctcagtagtgtatggaatgcctcaagcagtcatg
aactcaggtattgctgaaaaagagttttccatagattcctttgaaagccatattgtcaaa
gagatggcgtaa

DBGET integrated database retrieval system