KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1381Help
Entry
Glaag_1381        CDS       T01483                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604437..1605060
Genome map
AA seq 207 aa AA seqDB search
MIGRIRGTLIEKQPPEVLIDVSGVGYEIQIPMTSFYQLPEVGEQASVYTHFVVREDAQLL
FGFADKNERAVFRELIKASGVGPKLALTILSGMSGQNFMQCVAHEDITALVKLPGVGKKT
AERLVIEMRDRFKKLSLEQSAGDDFTLQGSNGIENTFVTSTDAKEEALSALIALGYKAQQ
ASKVINSVYVKDITSEALIREALRAML
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgattggtagaattcgcgggacattaattgaaaaacaaccacctgaagtgctaattgat
gtatcaggagtaggttatgaaattcagatccctatgaccagtttttatcaattaccagag
gtgggtgaacaagcaagtgtatacacgcactttgtggtccgcgaggatgcacagttactg
tttggatttgcggataaaaacgaacgtgcagtatttcgcgagttgatcaaagccagtgga
gtggggccaaaactggcattaactattttgtcgggtatgtcgggtcaaaactttatgcaa
tgcgtcgctcacgaagatattacggccttagtaaaactccctggtgtcggtaaaaaaacc
gcagagcgattagtgattgaaatgcgagaccgcttcaaaaagttaagtttagagcaaagc
gcaggggatgatttcaccctgcaaggctcaaatggtatagaaaatacgtttgtcacctcg
actgatgccaaagaggaagcactcagcgcattaatcgccttaggttataaagctcagcaa
gccagcaaagtcattaactctgtgtatgttaaagacattaccagcgaagcattgatccgc
gaagcgttgcgagcaatgctctaa

DBGET integrated database retrieval system