KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1403Help
Entry
Glaag_1403        CDS       T01483                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00071  Fatty acid degradation
gag00072  Synthesis and degradation of ketone bodies
gag00280  Valine, leucine and isoleucine degradation
gag00310  Lysine degradation
gag00362  Benzoate degradation
gag00380  Tryptophan metabolism
gag00620  Pyruvate metabolism
gag00630  Glyoxylate and dicarboxylate metabolism
gag00640  Propanoate metabolism
gag00650  Butanoate metabolism
gag00900  Terpenoid backbone biosynthesis
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
gag01212  Fatty acid metabolism
gag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Glaag_1403
   00630 Glyoxylate and dicarboxylate metabolism
    Glaag_1403
   00640 Propanoate metabolism
    Glaag_1403
   00650 Butanoate metabolism
    Glaag_1403
  Lipid metabolism
   00071 Fatty acid degradation
    Glaag_1403
   00072 Synthesis and degradation of ketone bodies
    Glaag_1403
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Glaag_1403
   00310 Lysine degradation
    Glaag_1403
   00380 Tryptophan metabolism
    Glaag_1403
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Glaag_1403
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Glaag_1403
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Glaag_1403
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Glaag_1403
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEE22363
UniProt: F4AHZ4
Position
1627245..1628429
Genome map
AA seq 394 aa AA seqDB search
MNNDSVVIVSAKRTPMGGFMGGLSTLNACELGASAITAALEEAGQDKPVIDEVIMGCVLP
AGLGQAPARQASIKAGLPLASGAITLNKVCGSGMKAVMLAHDLIKSGSAKSIIAGGMESM
SNAPYILPKARQGYRMGHGRMLDHMMLDGLENAYDGKAMGCFAQSKADEESVTREQMDEF
ALSSLTKASDAIANGLFKDEISPVTISSRKGEVVIENDEGPGNARPEKIPSLRPAFTKDG
TVTAANSSSISDGAAALLVMSEAEATEKGYTPLARIVGHSSNAIEPENFTVAPVGAIEKL
FAQTGWSKEDVDLFEINEAFAMVTMLGMSKLGLDPAKVNVKGGACALGHPIGASGARIIV
TLLHALKQRSLKKGVAAICIGGGEATAIAFEMLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgattcagtggttattgttagtgcaaaacgtacaccgatgggcgggtttatg
ggcggtttgtcaacactcaacgcgtgtgaacttggggcaagtgcaattactgctgctcta
gaagaagctggtcaagataagccggtgattgatgaagtcatcatgggctgtgtgttaccg
gcaggtttaggccaagcacctgctcgtcaagcaagtatcaaagcaggtttaccgctcgct
agtggggcgataacgctgaataaagtctgtggctctggtatgaaagcggtcatgcttgct
catgatttaattaagtcaggcagtgcgaagtcgatcatagcgggtggtatggagagtatg
tctaatgccccttatattttacctaaagcgcgccaaggttatcgtatgggacacggtcga
atgcttgatcatatgatgctcgatggtttggaaaatgcgtacgacggtaaagcaatgggc
tgttttgcacagtctaaagcggatgaagaaagtgttactcgtgagcaaatggatgaattt
gcgctgagctctttgacaaaagcgagtgacgcgatagctaatggtttatttaaagacgaa
attagccctgtgaccatatcttcacgcaaaggtgaggttgtaattgaaaacgatgagggg
cctggaaatgctcgccctgaaaaaataccttcattacgtcctgcgttcaccaaagatgga
acagtgactgcggcaaattcaagctcaatctcagacggtgcagctgcattgctggtgatg
agtgaagccgaagcaactgagaagggctatacaccactggcgcgcattgttgggcatagc
tctaatgccatcgagcctgagaactttaccgtagcccctgtcggtgcaattgaaaagctg
ttcgcacaaacagggtggtcaaaagaagacgtcgatttatttgaaattaacgaagccttc
gccatggtgactatgttaggcatgagcaaacttggtttagatccagcgaaagttaatgtg
aagggtggagcatgtgcccttggtcacccaattggcgcgtcaggtgcacgtattattgtg
accttgctacacgcccttaaacaacgtagtttgaaaaaaggtgttgctgcgatttgtatt
ggcggcggcgaagcgacagcgatcgcattcgaaatgttaggctaa

DBGET integrated database retrieval system