KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1428Help
Entry
Glaag_1428        CDS       T01483                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Glaag_1428
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Glaag_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1655448..1656050
Genome map
AA seq 200 aa AA seqDB search
MKLSPLILELINAFKVLPGVGPKSAQRMAFHLLERNRSGALQLSQVLHNAMEHVGHCKQC
RTFTESELCEICAHPTRSEAGTLCIVESPQDVVAIEQTAEFKGLYFVLMGHLSPIDGIGP
SEIGLDELANLLDNKALNEVILATNPTVEGEATAHYIGQMCSARDIQATRLAHGMPVGGE
LEYVDGNTLTHAFVGRRSLL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttagtcctcttattttagagctaattaatgcgtttaaagtgttacctggtgtg
ggcccaaaaagtgctcagcgtatggcgtttcatttattagagcgaaatagaagcggtgcc
ttgcagttgagccaggtgttgcataacgccatggagcatgtggggcattgcaaacaatgt
cgtactttcaccgaaagtgaattatgtgagatttgtgctcatcctacgcgcagtgaagca
gggactttgtgtattgttgaatcaccacaagacgtggtggcaattgagcaaactgctgag
tttaaaggcttgtactttgtgttgatggggcatttatcgcctatcgacggtatcggcccg
agtgaaatcggtttagacgagctggcaaatttgctcgacaataaagccttaaatgaggtg
atcttagccactaaccctacggttgaaggtgaagcgactgctcattatattggtcaaatg
tgttcagctcgcgatattcaagccacacgtttagcgcatggtatgccggtagggggcgag
ttagagtatgttgatggcaacacactaacccatgcctttgtcggtcgaagaagcttgtta
taa

DBGET integrated database retrieval system