KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1510Help
Entry
Glaag_1510        CDS       T01483                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741579..1742127)
Genome map
AA seq 182 aa AA seqDB search
MKIHSLYQLIFSATVLLSGCATQKTSSDLPHDAPQLTSSAQRTTNQACIDIIKESEGVRL
KAYRGPAGHWLIGYGHKAGVKQGMEINAPQAEVFLKNDLLKIEEQMSKLVKVPVNNNQFS
ALVCLGYNIGMGNLYKSTLLRLLNKGDYTGASDQFSVWRKAAGKVNAHLVKRRAKEKSLF
DK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccattcactctatcagctaatattttcagccacggtcttacttagtggttgt
gcaacccagaaaaccagctcagatttacctcatgatgccccgcagctcacttcatcagcg
caaagaaccactaaccaagcgtgcatcgatattattaaagaatcagaaggcgtgcgccta
aaagcgtatcgaggcccagcaggccattggttaatcgggtatggtcataaagctggggtt
aagcaaggcatggaaattaacgcccctcaagcagaagtattccttaaaaacgatttactc
aaaatagaagagcaaatgagcaagttagtaaaagtgcctgttaacaacaatcaatttagt
gcgttagtctgcttaggttacaacatcggcatgggtaacttgtacaaatccaccttattg
cgtttgctaaataaaggcgattacacaggtgctagcgaccaattcagtgtatggcgcaag
gctgcgggaaaagtaaatgctcaccttgttaagcgccgtgcaaaagaaaaaagcttgttt
gataaataa

DBGET integrated database retrieval system