KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1609Help
Entry
Glaag_1609        CDS       T01483                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gag00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gag00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1855648..1856916
Genome map
AA seq 422 aa AA seqDB search
MIKASFFTSFRMCSAPLMLIKRLQQCFWSPRYLYTVCCICGLVVQPATLNAQTLLKAQGN
EPLVSVREEVWGHYQGQDIKRFTLSNDNGMQVSVTNWGAYVTSILVPDKNGLIEDVVLGY
DSAEEYINDCCYNGATVGRFANRIAGGRFQVDGKAVQLSVKQTGGNKGNHAHGGEVGFNK
RLWQAKLTANGVEMHYLSPDGEEGYPGNAQVSVRYSLNRDNEFTVHFSASSDKTTPINLI
SHIYFNLTGYQKRNIEQHKLQVNAHKIVQVKKGLLPTGKLIDVTGTPFDLTSPVALHRPL
TSMHEQLKLAQGMDKAHGGFDHTWVFDQYDGKLRYQVQLSEPNSGRVLDILTTQPGVHVY
TGNFMNGSAKGKQGKLITFRSGVALETQHFADSVNQPGFPNTLLRPGQAYSESTVYRFGS
KH
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagccagctttttcacttcttttcgtatgtgtagtgcccccttgatgctaata
aaacggctacagcaatgcttttggtcgcctcgatacctttatacagtgtgctgtatatgt
gggttggttgttcagcctgcgacattaaatgcgcaaacattactcaaagcgcaaggtaat
gagcccttggttagcgttcgcgaagaagtatgggggcattatcaaggacaagatatcaaa
cgattcactttatctaatgacaatggcatgcaggttagtgtgaccaattggggcgcctat
gttacgtcgattttagtgccggataagaacggcctgatagaagacgtggtgctaggctac
gacagtgctgaagaatatatcaatgactgttgttataacggcgcgacggtcgggcgcttc
gcgaatcgtattgcaggtgggcgttttcaagttgatggaaaagccgtacagttaagtgtt
aagcagacgggggggaataaaggtaaccacgcccatggtggggaggtcggctttaataaa
aggctgtggcaagccaagctaaccgcaaatggggtagagatgcattacttatcccctgac
ggtgaagaaggctatccaggtaacgcgcaagtgagcgtacgttatagcttgaatagagac
aatgaatttaccgttcactttagcgcttcaagtgataaaacaacgccaatcaaccttatt
tctcatatttattttaatttaaccggttaccagaagcgtaatatcgagcagcataaatta
caggttaacgcgcataaaatcgtgcaggttaaaaaggggttattgcccacaggtaaattg
attgatgtcactggcacaccgtttgatttaacgtcaccggtagcattgcaccgccctttg
accagtatgcatgagcaattgaagctggctcaggggatggataaagctcacggcggtttt
gatcatacttgggtgtttgaccagtatgatggtaagttgcgttatcaagttcagcttagc
gagcctaacagcggccgagtgttggatattttgaccacgcaacctggtgtgcatgtgtac
acgggcaatttcatgaacggtagcgcaaaaggcaagcaaggtaagttgataacatttcgc
agtggtgttgcgctagaaacgcagcactttgctgattcggtaaatcaaccagggtttcct
aatacgcttttgcgaccggggcaagcctatagtgaatctactgtttatcgttttgggagc
aaacattaa

DBGET integrated database retrieval system