KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1620Help
Entry
Glaag_1620        CDS       T01483                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Glaag_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1878414..1879685)
Genome map
AA seq 423 aa AA seqDB search
MSVPYVFEAYGLKAYELNTCGLKRNILAISRSILTLVLMFAAAISHASAAINANESALSH
NVAALSQKESATRQISSLTAHFNKQFLVGSAINAQQAKKTNKDTHAIIIAQFNTITPENE
MKWERIHPKPDKYEFSLSDEYVNYGLTNNMFTIGHTLVWHSQTPDWVFEDAQGKPIPRLA
LLARMKDHIHTIVSRYKGKIKGWDVVNEALNEDGSLRDSKWRQIIGDDFIEKAFTYAHEA
DPNAELYYNDYNLYKPDKSAGAARLIKSLQDKGIPVHGVGLQGHYSLTHPDLSELDEALT
LFSTLGIQSMITELDVSVLPFPSEAEQGADISQDLDLQKALNPFPNGLPQKQQDALSARY
RALFSLFLKQQNHLSRVTFWGVNDANSWRNNWPMRDRTDYPLLFDRTNRPKAAYDAVIAL
PVD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcccttacgtattcgaagcttacgggctaaaggcttacgagttaaatacttgc
ggtttaaaacgcaacattttagcaatctcacgttctattttgacacttgtattaatgttc
gcggctgccataagccatgcaagcgcagctataaacgcaaatgaatcagccttgagccac
aatgtagcagccctgagtcaaaaagaatctgctacaagacaaataagcagcttaacagca
cattttaacaagcagtttttagtgggcagcgctatcaacgcacagcaagccaaaaaaact
aacaaagacactcacgcaataatcattgcgcagttcaataccatcaccccagaaaacgaa
atgaagtgggaacgtattcacccaaaacctgacaagtacgaattttcactcagtgatgag
tatgtcaattacggcttgaccaacaacatgttcaccattgggcatacgcttgtatggcat
agccaaacacccgattgggtatttgaagatgcccaaggcaaaccgatacccagactggcg
ctgctagcgcgcatgaaagatcatattcataccatcgttagtcgctataaaggcaaaata
aaaggctgggacgtggtcaatgaagcactcaatgaagatggcagtttaagggattcaaaa
tggcggcaaatcattggcgacgactttattgaaaaagcatttacctatgctcacgaagcc
gatccaaacgcagagctgtattacaacgattacaatctatacaagcctgataaaagtgct
ggggctgcacgtttgattaaatcactacaggacaaaggaatacccgttcacggtgttggt
ttacaggggcattattctttgactcacccagatttaagtgagttagacgaggcattaacg
ttattctctactttaggtatacagtcgatgatcactgaattagatgtctctgttctgccc
tttccaagcgaagctgaacaaggtgcagatatcagtcaagacttagacttgcaaaaagcg
ctgaatccatttccaaatggtttgccacaaaaacagcaggatgcgttaagtgcccgatac
agagcccttttttcattgtttttgaagcagcaaaatcacttgtctcgcgtcactttctgg
ggtgttaatgatgccaacagttggcggaataattggccaatgcgtgatagaacggattac
ccactactgtttgatcgaacgaatcgacccaaagcagcctatgatgcagtaattgcgctg
cctgtagactga

DBGET integrated database retrieval system