KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1719Help
Entry
Glaag_1719        CDS       T01483                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Glaag_1719
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Glaag_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1995840..1996700)
Genome map
AA seq 286 aa AA seqDB search
MDQTLDWWPSPAKLNLFLHINGRYPNGYHKLQSLFQLLDKGDELAFSITPHSDIELLTPI
EGVANEDNLIVKAARLLQAHTNCQQGCQIQLRKVLPMGGGIGGGSSNAATTLIALNYLWK
CNLSLTELAKLGLVLGADVPVFVMGNTAFAQGVGEQLTPASLAQKHYLVVFPQCHVSTAE
VFNAPELPRNTPVISWQEYDFDQTHNDCQQLVCNRFENVANTLRWLLEYAPSRMTGTGAC
LFAVFTSNQEAENVLANLPSGCSGFVAKGVDVSPVHDKLAHLDSIS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaacactagattggtggcctagccccgctaaactgaatctcttcttgcacatt
aacgggcgctaccctaacggctaccataaattacaaagcctatttcagctattagataaa
ggcgatgagttagctttttcaatcacgcctcacagtgatattgaattactcacgcccatc
gaaggggtagccaatgaagacaacttgattgttaaagctgcccgtttactgcaagcacat
acaaattgccagcaaggctgtcagattcaattacgcaaagtattgcctatgggcggtggc
attggtggcggttcgtcgaatgcagccaccacattaattgcccttaactatttatggaaa
tgtaacttaagcctgacagaactcgctaaattaggcttagtactgggtgcggatgtgccg
gtttttgttatgggtaacactgcgtttgcccaaggggttggtgagcagcttacacctgct
agccttgctcaaaagcactatttagtagtgtttccgcagtgccacgtatcaaccgcagaa
gtctttaacgctcctgaactgccgagaaatacaccagttatatcttggcaagagtatgat
tttgaccaaacccataatgactgtcagcaattagtctgcaatcgctttgagaatgttgca
aatacattacgctggttgttagaatacgcgccgtctcgaatgacaggcacaggtgcttgt
ttatttgcggtctttaccagtaaccaagaagcagaaaatgtactcgctaacttaccatca
ggttgctcaggttttgtcgctaaaggggtcgatgtgtctcctgtgcatgacaaattagcg
cacctagatagtattagctag

DBGET integrated database retrieval system