KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1740Help
Entry
Glaag_1740        CDS       T01483                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Glaag_1740
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Glaag_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2023726..2025894
Genome map
AA seq 722 aa AA seqDB search
MVTDSMVKQMANNDDASKTKQLDAQASVAAQVPTTTSILQNLLKIGRIRPLDVAFAEFVM
LHEPGKHAVDVNGIHVVGLLAAYLSSRLGEQDSCLNLDNTYQPFLPFYRFESIDQLLPML
SASTCVAVVDERYTGEVANASTDKSTEKNALKSTASTSCEPVFAPQSQPLILQGSELYMQ
RYWQYEVQLASKINSMSGRATTLDVAQGQALLAQLFATHESKGSLAKNSLAKNSLAKNSA
QDQQAAPIDWQQVAVCLAASQNVSVITGGPGTGKTTTVIRLMALLQGLARHAHKKLQIKL
AAPTGKAAARLSQSISAAMGKLPTALQADLPNQCSTIHRLLGSIANSPYFRFNAQHPLHL
DVLIVDEASMVDLPLMSKLFAALPAHAKIILLGDKDQLASVEAGSVLSDICAAALNFSPT
VYDQPPPYSDEALRVIKDLCQIDLQVSTPNKAPISNSLALLHKSYRFSEKSGIGRLARAI
NSGKLAPSKALFADERYPDVVWQTSDEPKALVAKLLPDYQAYFEHVKHVCAQGTLHSKGL
EVFSLLQQQQVLCAQKEANWGVLQVNALIESELNKKGAIELGRDFYPGRPVMLKQNDHSL
GLFNGDIGIVMPDADNDELMKVWFVTEQNTLRGVLPSRLPPHDTVYAMTIHKSQGSEFDH
VYLCLPRVETGSQARLLSRELLYTGLTRAKKSFTLYSDEQALSLSIARRCQRGSGLAKRL
LF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccgattcaatggtaaagcaaatggccaacaatgatgatgcatctaagacaaaa
cagctagatgctcaggcatctgtcgctgcacaggtaccaaccacgaccagtatcttacaa
aatttgttgaaaatagggcgtattcgcccattggacgtggcatttgctgaatttgtaatg
cttcacgaacctggaaaacacgctgtcgatgtgaacggtattcatgtggtggggttattg
gcagcttatttaagtagccgcttgggggagcaagatagctgccttaatctagataacact
tatcagccctttttgcctttttatcgcttcgaatctatcgaccaactattgcctatgtta
agcgcatcgacttgtgttgctgtggttgatgagcgatacacaggggaggtagcgaatgcc
agcactgataagagcactgaaaaaaacgctttaaaaagtacggcatcgacaagctgcgag
cccgtgtttgcgccccaaagccagcctcttattttacaaggcagtgaactttatatgcag
cgttactggcaatatgaagtacagctggcgagtaaaataaatagcatgtcggggcgtgca
acgacgttagatgttgcccaaggccaagccttactagctcagctgtttgctacgcatgaa
tcaaaaggcagcttggctaaaaacagcttggcaaaaaacagcttggcaaaaaacagcgca
caagatcagcaagcagcacctattgactggcagcaagtggcagtgtgcctggcggcaagt
caaaatgttagcgttataacaggcggcccgggtacgggaaaaaccaccacggttatacga
ttaatggctttactgcaggggctagcaaggcatgcacataaaaaactgcaaattaaactt
gccgcgccgaccggaaaggccgcagcgcgtttgagtcagtctatcagtgcggctatgggc
aaactgcccacggctttacaagcagatttacccaaccagtgcagcaccatacataggtta
ttaggcagtattgcgaacagtccttattttcgttttaacgctcagcatcccctgcattta
gatgtgttgatcgtggatgaagcctccatggttgatttacctctgatgagcaaattattt
gcggcgttacccgcccacgccaaaatcattctgctgggggataaagatcaacttgcctcg
gtagaggcgggcagtgtgctgtcagatatatgcgccgcagcgcttaatttctcgcccact
gtgtatgatcagcccccgccatacagcgatgaggcattgagggtaattaaagatttgtgt
caaattgatctgcaggtaagtacaccaaacaaagcaccgatcagtaatagtttggctttg
ctacataagagttatcgtttcagtgaaaaaagcggtattggtcgcttagcgcgggcaatt
aatagtggcaaattagccccttcaaaagcgttattcgctgatgagcgctacccagatgtt
gtttggcaaaccagcgatgagccaaaagccttggtggctaaactattgcctgattaccaa
gcctattttgagcatgtaaaacacgtttgtgcgcaaggaacgctgcatagtaaggggctt
gaggttttcagtttgttacaacagcaacaagtcctgtgcgcacaaaaagaggcgaattgg
ggcgtactacaagtcaacgcgctgatagaatctgaactcaataaaaagggcgctattgaa
ctagggcgtgatttctaccccggtcgccctgtgatgcttaaacaaaatgatcatagttta
gggctctttaacggtgatattggcatagtaatgccggatgctgataacgacgaactgatg
aaagtgtggtttgtcacagagcaaaataccttgcgaggggtgcttccgagtcgcttgccc
cctcatgacacagtgtacgcgatgacaattcataaaagccaaggctcggagttcgatcat
gtttatttgtgtttgccacgggtagagacaggctctcaagctcgattactcagccgtgaa
ttactttatacgggcctaacgcgggcgaaaaagtctttcaccttgtacagcgatgaacag
gcgctctctcttagtattgcaaggcgctgtcagcggggcagcggtttagccaaacgctta
ctcttttaa

DBGET integrated database retrieval system