KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1767Help
Entry
Glaag_1767        CDS       T01483                                 

Definition
pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family protein (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Glaag_1767
Enzymes [BR:gag01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Glaag_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2058509..2059510
Genome map
AA seq 333 aa AA seqDB search
MPLSRFNKIQLGVFPTPIQKLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADA
LAKDSDCIITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNVANGNLLLDQLFAAHIH
WSGDKRKGEDIPNIVAALREQGRNPYVVPYGGSNMIGSLGFINAFYELHAQCKDAAMPAE
FSDIVFASSSGATHCGLVLGKAVCNVSSRIIGINIDKDEQGKDSYKSQLHTLIKDTANKL
AVGYPADIDEIQLKDDYIGAGYGVVGELEREGIALCAQLEGILLDPVYTGRAMGGLIDMI
RKGRFSADSNVLFWHTGGAPALFSYAEVLQQVD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccactaagtcgttttaataaaattcaattgggggtatttccaacgcccatccaaaag
ttaccgcgtttatctgctcatttaggtggcccgcagatatatattaagcgtgatgattta
accggtttggccttaggaggcaataaaacgcggaaacttgaatatttgttggctgatgcg
ttagcgaaggacagtgactgtattattactgctggcgctgcgcaatcgaaccattgccgt
caaaccgccgcagccgcggcaatgctggggttagaatgtcatttagtacttggcggtcaa
gcaccgaacgttgcaaatggcaatctgctacttgaccagctctttgctgcgcatatccac
tggagcggagataaacgaaaaggtgaagacattcctaacattgtggcagctttacgcgaa
cagggtcgaaatccttatgtggtgccgtacggcggctctaatatgattgggtctctgggc
ttcatcaacgccttttatgagttacacgcgcagtgcaaagatgccgcaatgccagctgaa
ttctccgacatcgtgtttgcttctagctcaggtgcgacgcactgcggtttagtgttaggt
aaagcggtgtgcaacgtaagcagccgtataattggcattaatattgataaggacgagcag
ggtaaggatagctataagtcgcagttacataccttaataaaagacactgcgaataaactg
gcggtgggctatccagctgatattgatgagattcaattaaaagatgactacataggtgca
ggatatggcgttgtcggggaattagagcgagaaggcatagcattatgcgcgcaacttgaa
ggcattttactcgatcccgtgtatacaggacgagcaatgggcggattgatcgatatgata
cgcaaagggcgttttagtgctgacagtaatgtgctgttttggcatacgggcggcgctcct
gcgctcttttcatatgcagaggtattgcaacaagttgattga

DBGET integrated database retrieval system