KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1767Help
Entry
Glaag_1767        CDS       T01483                                 

Definition
pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family protein (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:gag00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2058509..2059510
Genome map
AA seq 333 aa AA seqDB search
MPLSRFNKIQLGVFPTPIQKLPRLSAHLGGPQIYIKRDDLTGLALGGNKTRKLEYLLADA
LAKDSDCIITAGAAQSNHCRQTAAAAAMLGLECHLVLGGQAPNVANGNLLLDQLFAAHIH
WSGDKRKGEDIPNIVAALREQGRNPYVVPYGGSNMIGSLGFINAFYELHAQCKDAAMPAE
FSDIVFASSSGATHCGLVLGKAVCNVSSRIIGINIDKDEQGKDSYKSQLHTLIKDTANKL
AVGYPADIDEIQLKDDYIGAGYGVVGELEREGIALCAQLEGILLDPVYTGRAMGGLIDMI
RKGRFSADSNVLFWHTGGAPALFSYAEVLQQVD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccactaagtcgttttaataaaattcaattgggggtatttccaacgcccatccaaaag
ttaccgcgtttatctgctcatttaggtggcccgcagatatatattaagcgtgatgattta
accggtttggccttaggaggcaataaaacgcggaaacttgaatatttgttggctgatgcg
ttagcgaaggacagtgactgtattattactgctggcgctgcgcaatcgaaccattgccgt
caaaccgccgcagccgcggcaatgctggggttagaatgtcatttagtacttggcggtcaa
gcaccgaacgttgcaaatggcaatctgctacttgaccagctctttgctgcgcatatccac
tggagcggagataaacgaaaaggtgaagacattcctaacattgtggcagctttacgcgaa
cagggtcgaaatccttatgtggtgccgtacggcggctctaatatgattgggtctctgggc
ttcatcaacgccttttatgagttacacgcgcagtgcaaagatgccgcaatgccagctgaa
ttctccgacatcgtgtttgcttctagctcaggtgcgacgcactgcggtttagtgttaggt
aaagcggtgtgcaacgtaagcagccgtataattggcattaatattgataaggacgagcag
ggtaaggatagctataagtcgcagttacataccttaataaaagacactgcgaataaactg
gcggtgggctatccagctgatattgatgagattcaattaaaagatgactacataggtgca
ggatatggcgttgtcggggaattagagcgagaaggcatagcattatgcgcgcaacttgaa
ggcattttactcgatcccgtgtatacaggacgagcaatgggcggattgatcgatatgata
cgcaaagggcgttttagtgctgacagtaatgtgctgttttggcatacgggcggcgctcct
gcgctcttttcatatgcagaggtattgcaacaagttgattga

DBGET integrated database retrieval system