KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1779Help
Entry
Glaag_1779        CDS       T01483                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_1779
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glaag_1779
   00650 Butanoate metabolism
    Glaag_1779
  Energy metabolism
   00190 Oxidative phosphorylation
    Glaag_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2070817..2071164
Genome map
AA seq 115 aa AA seqDB search
MLTNQANFKRDGVQDYVTVRATAIIMTVFSLYMAWFFLSTETVTYEIWRGLFSSLGMKVF
TFAALVSVMLHIRIGFWQVLTDYVKSTGLRAVVQFFINLVAFVYVAVGLFVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctaactaaccaagcgaattttaaacgcgatggtgttcaagattacgtaaccgtgcgt
gccaccgcgatcattatgaccgtgtttagtttatacatggcgtggtttttccttagcact
gaaactgtgacctacgaaatctggcgtggcttattttcttcattaggcatgaaggtcttc
acgtttgcagcgttagtatctgtcatgttgcatattagaatcggtttttggcaagtgcta
actgattacgttaaatcaacaggccttcgtgctgttgtacaattttttattaacctagta
gcgttcgtatacgttgctgtaggtttgtttgttttgtggggtctataa

DBGET integrated database retrieval system