KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1779Help
Entry
Glaag_1779        CDS       T01483                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00020  Citrate cycle (TCA cycle)
gag00190  Oxidative phosphorylation
gag00650  Butanoate metabolism
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
Module
gag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glaag_1779
   00650 Butanoate metabolism
    Glaag_1779
  Energy metabolism
   00190 Oxidative phosphorylation
    Glaag_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Cation_ATPase_C
Motif
Other DBs
NCBI-ProteinID: AEE22729
UniProt: F4AM49
Position
2070817..2071164
Genome map
AA seq 115 aa AA seqDB search
MLTNQANFKRDGVQDYVTVRATAIIMTVFSLYMAWFFLSTETVTYEIWRGLFSSLGMKVF
TFAALVSVMLHIRIGFWQVLTDYVKSTGLRAVVQFFINLVAFVYVAVGLFVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctaactaaccaagcgaattttaaacgcgatggtgttcaagattacgtaaccgtgcgt
gccaccgcgatcattatgaccgtgtttagtttatacatggcgtggtttttccttagcact
gaaactgtgacctacgaaatctggcgtggcttattttcttcattaggcatgaaggtcttc
acgtttgcagcgttagtatctgtcatgttgcatattagaatcggtttttggcaagtgcta
actgattacgttaaatcaacaggccttcgtgctgttgtacaattttttattaacctagta
gcgttcgtatacgttgctgtaggtttgtttgttttgtggggtctataa

DBGET integrated database retrieval system