KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1783Help
Entry
Glaag_1783        CDS       T01483                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_1783
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glaag_1783
  Amino acid metabolism
   00310 Lysine degradation
    Glaag_1783
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Glaag_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2076669..2078159
Genome map
AA seq 496 aa AA seqDB search
MSIDIKVPVLPESVADASIATWHVKVGEQVTRDQNLVDIETDKVVLEVVAPADGVLSDIL
DEEGATVLGEQVIAKFEEGAGAQKAQEQSAPATEKTSSNKGESVEIKVPVLPESVADATV
ATWHVQPGDAVSRDQNLVDIETDKVVLEVVAPADGTLSEILAQEGETVMGEQVIANFSAG
AAPAKSDAPAKASGDDDSSDAENDALSPSVRRLLAEKGIDAANIKGTGKGGRITKEDVEK
SLSAPSKAAAPAKEAPAAPSLAGERSEKRVPMTRLRKTIASRLLEAKNSTAMLTTFNEVN
MKPIMDLRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASLDGDDICYHNYFDV
SIAVSTPRGLVTPVLRDCDTLGMAGIEGGIKELALKGRDGKLSMADMQGGNFTITNGGVF
GSLLSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGKESVGFLV
TIKEMLEDPTRLLLDV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatagatattaaagtaccggtattgccagaatctgtggccgatgcatcaattgcc
acgtggcatgtgaaggttggcgaacaggtgactcgcgatcaaaacttggttgatattgaa
accgataaagtggtacttgaagtggttgctccagcagatggcgtattaagcgacattctg
gatgaagaaggtgcgaccgtattaggtgagcaagtgattgctaaatttgaagaaggggcg
ggtgcacaaaaagcgcaagagcaaagtgcaccggctacagagaaaacatccagtaataaa
ggtgagtcagtggagattaaagtacctgtgctgcccgaatcagtggcagatgcaaccgta
gcaacatggcatgttcaaccaggcgacgccgtttcgcgtgatcaaaacttggttgatatt
gaaaccgataaagtggtgctagaagtggttgcgcccgccgatggcactttgagcgaaatt
cttgctcaagaaggtgaaacggtaatgggtgagcaagttattgcaaacttctcagccgga
gctgcgcctgctaaatcagatgcacctgcaaaagcaagcggtgatgatgatagtagcgac
gcagagaacgatgcgcttagcccttctgtacgtcgtttacttgctgaaaaaggcattgat
gcagccaacattaaaggcacaggtaaaggtggtcgcattactaaagaagacgtcgaaaag
tctctttctgcgccaagtaaagccgccgcaccagcaaaagaagcgcctgctgcgccttca
ttagctggcgaacgctctgaaaaacgcgtacctatgactcgtttgcgtaagaccatcgca
agtcgcttacttgaagcgaaaaactcaacggcgatgctcacgacctttaacgaagtcaac
atgaagccaatcatggatcttcgtaagcaatatcaagagtcgttcgaaaagcgtcacggt
attcgtctaggtttcatgtctttctacgtcaaagcagtaaccgaagcgcttaagcgtttc
cctgaagtgaatgcgtcacttgatggtgatgatatttgttaccacaactacttcgatgta
tcgattgcggtttctactcctcgtggtcttgttacccctgtattgcgtgattgcgatacg
ttgggaatggctggcattgaaggcggcattaaagagcttgcacttaaaggccgtgacggt
aaattgtcaatggctgacatgcaaggcggtaacttcaccatcactaacggtggtgtattt
ggttcattgctttcaacgcctattatcaacccaccacagagtgctatcttgggaatgcat
aaaatccaagatcgtcctatggcggttaatggcaaagtggaaattttgcctatgatgtat
ttagcactttcttatgatcatagaatcatcgacggtaaagagtcggttggtttcttggta
acgatcaaagaaatgctagaagatccaacgcgtctgctactggatgtttaa

DBGET integrated database retrieval system