KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1784Help
Entry
Glaag_1784        CDS       T01483                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_1784
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Glaag_1784
   00640 Propanoate metabolism
    Glaag_1784
   00660 C5-Branched dibasic acid metabolism
    Glaag_1784
Enzymes [BR:gag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Glaag_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2078283..2079452
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSEGYAAETPQAAVEAADRIGGTEWVVKCQVHAGGRGKAGGV
KLVKNKDEIKAFAQKWLGQNLVTYQTDEAGQPVSKILVESCTDIAQELYLGAVVDRASRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPLVGAQPYQAREIAFKLGLKGVQIKQFTQI
FMGLAKLFEEKDIALIEVNPLVIKDDGNLHCLDAKVAMDSNAAYRQPKLQEMHDPSQEDA
REAQAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGSPANFLDVGGGATKERVAE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVTIPVVVRLEGTNAELGREV
LANSGLDIIAASSLTDAAKQVVKAAGGAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcagggtaaacaattattcgctgaatacggtttacctgtatct
gaaggatatgctgcggaaactccgcaggctgcagttgaagcagcagatcgtattggcggt
actgaatgggttgtgaaatgtcaggttcacgctggtggtcgcggtaaagcaggcggtgtt
aagcttgttaagaacaaagatgagatcaaggcatttgcacaaaaatggcttggtcaaaac
ttagtgacttatcagacagatgaagctgggcaaccagtaagcaaaatcttggttgaaagc
tgtacagatattgctcaagaattgtacctaggtgcagttgttgatcgtgcttctcgtcgc
gttgttttcatggcatctaccgaaggtggtgttgaaattgaaacagttgcagaagagaca
cctgaaaaaattcttaaggctgagatcgaccctctagtaggtgctcaaccttaccaagca
cgtgaaatcgcgttcaagcttggccttaaaggcgttcaaatcaaacaattcactcaaatc
ttcatgggtttggcgaaattgttcgaagaaaaagacattgcacttatcgaagttaacccg
cttgttattaaagatgacggtaaccttcattgtcttgacgctaaagttgccatggacagc
aacgctgcctaccgtcaacctaagcttcaagaaatgcacgatccttcacaggaagatgca
cgtgaagcacaagcggctaagtgggagcttaactacgtagcacttgatggtaacatcggt
tgcatggttaacggtgcaggcctagcaatgggtactatggatatcgttaacttgcacggt
ggttcacccgctaacttcctagacgttggtggcggtgcaactaaagagcgtgttgctgaa
gcattcaaaattatcctatctgactcaaatgttgccgctgtattggtaaacatttttggt
ggtatcgtacgttgtgacatgatcgctgaaggtattatcggagcggttaaagaagtcggt
gtaactatccctgttgttgtacgtttagaaggtaccaacgcagagcttggccgtgaagta
ttggctaactcaggtttagatatcatcgctgcttctagtttaacggatgctgcaaaacaa
gttgttaaagctgccggaggtgctgcatga

DBGET integrated database retrieval system