KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1924Help
Entry
Glaag_1924        CDS       T01483                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Glaag_1924
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Glaag_1924
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Glaag_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2246433..2246999)
Genome map
AA seq 188 aa AA seqDB search
MYKNVEVHMKKLLAITCLMLFCNLAHSAQCPDLLKFVKRKLNSQETVNMCDAYAGKTVLF
VNTASYCGFTPQFKGLEDLYSKYKDQGLMVLGFPSHDFNQEDKDEGKTAELCELTYGVEF
PMFEAMPVRGRDADPLYKMLAKKSGTTVKWNFYKYLMDKNGNLVNTYASSTKPTDPQFIS
TIEDTLKR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaatgtcgaggttcacatgaagaagttactcgctatcacttgcctaatgctc
ttttgcaacttggcgcacagtgcgcagtgtccagatttacttaagtttgtaaaacgcaaa
cttaactcacaagaaacagtcaatatgtgtgacgcctatgctggcaaaaccgtattgttt
gtcaatacagcaagttattgtggatttaccccgcaatttaaaggcttagaagacttatac
agtaagtataaagatcaaggcttgatggtattaggctttccttcgcatgattttaatcaa
gaagataaagatgaaggcaagacggctgagctgtgcgaactaacctacggcgtggagttc
cctatgtttgaagccatgcctgtacgcgggcgtgatgctgatcccttgtataaaatgttg
gctaaaaaatcaggcaccacagtgaagtggaatttttataaatacctgatggacaaaaac
ggcaacttggtcaatacctatgcctcttcaacaaaaccgacggatccacaatttattagt
acaatcgaagacaccttaaagcggtag

DBGET integrated database retrieval system