KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1942Help
Entry
Glaag_1942        CDS       T01483                                 

Definition
xanthine dehydrogenase, molybdopterin binding subunit (EC:1.17.1.4)
Orthology
K13482  
xanthine dehydrogenase large subunit [EC:1.17.1.4]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Glaag_1942
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Glaag_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263341..2265695)
Genome map
AA seq 784 aa AA seqDB search
MRKLIEQPFTSNPQGKVGKSHPHESAIRQVSGQARYVDDMPEPGNLQYAAVGTSPEASGV
INNIDLTEVWTSPGVIDVITVDDVPGHVDIAPVFDGDPIFAQGRVLFNGQAMFAVLADST
HHARQAALKAKIDITPTTACLSVSEAKQQDNFVRPPHFMHQGDFASAFAQSECTAQGHLS
IGGQEHMYLEGQVSMAINDEEDRVLVYTSSQHPSEVQKLIAEVLGCKLNKVVVDMRRMGG
GFGGKETQAAQWACIAALLAKRNQCAVKLRLPRMQDMIATGKRHPFENSYQVGFNQDGLI
TAAAIDINGNCGHSPDLSDAIVDRAMFHCDNGYYLENVNVAGHRCRTNQVSHTAYRGFGG
PQGMIMAEVMMDAIARKVGKDPLTVRKLNLYGENERNLTPYGMTVEHNLLGDLIDRLETS
SDYWARRETITQFNKNSPIVKKGLALTPVKFGISFTAKHLNQAGALLHVYTDGSMQINHG
GTEMGQGLHTKIGQIVANEFGISLHDVEVTATRTDKVPNTSPTAASSGTDLNGKAAQNAC
IIVKQRLAEFYAEQIDDNALSADDVVFSDNRVTLAEHSIDFVQLVQDAYIGRVSLSSTGF
YKTPKIHYDRSTGNGRPFFYFAYGASVSEVAVDTLTGEYKVERVDILHDVGRSLNPAIDI
GQIEGGFIQGMGWLTTEDLKWDNKGRLISNNPATYKIPAIGDTPEVFNVDLYPRDNDEDS
IYHSKAVGEPPFMLANSVWCAIKDAISSVTDYKVDPPLPAPATPEAVLKCITALENGLFS
DKVS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacttattgaacagccgtttaccagtaacccacagggcaaggtcggtaaatct
catccccacgaaagcgccattcgtcaagtgagcggacaagctcgttacgtggatgacatg
cccgaaccaggcaatttacaatatgccgctgtgggcaccagcccagaagcatcaggcgta
ataaacaacatagatttaactgaggtttggactagccctggggtcattgatgtcattacc
gtagatgacgtaccaggccacgtagatattgcaccggttttcgatggcgatccgattttt
gcgcaaggtcgcgttttatttaatggccaagctatgtttgctgtgctggctgacagcacg
catcacgccagacaagcggccctaaaagcgaaaattgacattactcctaccacggcttgc
cttagcgtatccgaggcgaagcaacaggacaattttgtacgaccgccacactttatgcac
caaggagactttgccagcgcgttcgcccaaagtgaatgcactgctcaggggcatttaagc
ataggtggtcaagagcacatgtaccttgagggtcaagtgtccatggcgataaacgatgaa
gaagatcgcgtcttggtgtatacctctagccaacacccaagtgaagtgcaaaaactgatt
gctgaagtgctagggtgtaaattaaacaaagtcgtggtcgacatgcgccgaatgggcggt
ggttttggtggtaaagaaacccaagctgctcagtgggcatgcattgcggcactacttgca
aagcgtaatcaatgcgcagtaaagcttcgtttaccacgcatgcaagacatgatcgccacg
ggaaaacgccatccattcgaaaacagctatcaagtgggttttaaccaagatggtttaatc
actgctgctgcaatcgacatcaatggtaattgcgggcactcgccggacttatcagacgca
attgttgatagggccatgtttcattgcgacaacggttattacctcgaaaacgtgaatgtg
gccggtcaccggtgccgtactaatcaagtatcacacaccgcctaccgcgggtttggcggc
ccacagggcatgataatggctgaagtcatgatggatgccattgcgcgtaaagtcgggaaa
gatccactaactgtgcgcaaattgaatctatacggtgagaacgaacgtaacttaacgcca
tacggcatgaccgttgagcacaacttgcttggcgatttaatcgacaggttggaaacatct
tctgattactgggcaagaagagaaacgattactcaattcaataaaaacagcccaatcgtt
aagaaaggtttagcactgacgcccgttaaattcggcatctcgttcaccgctaagcatttg
aaccaagccggcgccctgttgcatgtttacacagatggcagcatgcaaatcaaccatggt
ggcactgaaatgggccaaggtttgcacactaagattgggcaaattgtcgccaatgaattt
ggtatatcgctgcatgacgtagaggtcacggccacgcgaacggataaagttcccaacacc
tcccccactgcggcatcaagtggtaccgatttgaacggaaaagcggcacaaaatgcatgt
atcatcgttaaacagcgcttagcagaattttacgctgagcagattgatgataatgcgtta
tctgctgatgatgtggttttctcagacaatcgcgtcacattggccgaacatagcattgat
tttgtccagttagtccaagatgcctacataggtcgtgtatcactgtcttcaacaggtttt
tataaaacaccaaaaattcattacgatagaagcacaggcaatggtcgtccgttcttttat
tttgcttatggagcgtcagtgtccgaagtagccgttgatactctgaccggtgaatacaag
gtagaacgtgttgatattttgcatgatgtaggccgcagccttaacccagcaattgacatc
ggccagattgaaggcggctttattcaaggtatgggctggcttactacagaagatttaaag
tgggacaacaaaggccgattgatcagtaacaacccagcaacctataaaatacccgctatt
ggtgacacgccagaggtattcaatgtcgacttgtacccacgcgacaacgacgaagacagt
atctatcattcaaaagcagtcggtgagccaccctttatgttagccaattcggtttggtgc
gcgattaaggatgctatttcaagcgtgactgactataaggtcgacccacctttgcctgcc
cctgccacgccagaggcggtgctaaaatgcataacagccctagagaacggtttgttctct
gacaaggtaagctaa

DBGET integrated database retrieval system