KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2071Help
Entry
Glaag_2071        CDS       T01483                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00300  Lysine biosynthesis
gag01100  Metabolic pathways
gag01120  Microbial metabolism in diverse environments
gag01230  Biosynthesis of amino acids
Module
gag_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Glaag_2071
Enzymes [BR:gag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Glaag_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18 Glyco_hydro_18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEE23016
UniProt: F4AQ85
Position
complement(2425406..2426536)
Genome map
AA seq 376 aa AA seqDB search
MSCEVLALTEELINRQSVTPEDAGCQQLMAEYLAPLGFEIETMVFEDTTNMWARKGKGDP
VFCFAGHTDVVPSGPAEKWTFPPFEATQHEGQLYGRGSADMKGSLAAMLVATKAFVTKHP
EHTGSIAFLITSDEEGPFINGTTRVIDTLEARNEKMTWCLVGEPSSTTLVGDVVKNGRRG
SLTGDIVIKGVQGHVAYPHLAKNPIHASAPAFAELAQTHWDSGNASFPPTSFQVSNINSG
TGAGNVIPGDLTACFNFRFSTEVTDKQLIERVISILDKYDFDYEIDWTFNGQPFLTDSGK
LVEATQDAIKDVTGRQTELSTAGGTSDGRFIAPTGAQVIELGPVNATIHKIDENVNIKDL
AELAKIYQGILQRLLA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgaagtattagccctgaccgaagaattaattaaccgccaatctgtgacccca
gaagacgccggttgccagcagttaatggcagaatacttagctccattaggtttcgagatt
gaaactatggtgtttgaagacaccacaaacatgtgggcacgcaaaggcaaaggcgatcct
gtgttttgctttgccggccacaccgatgttgtgcccagtggacctgcagaaaagtggacg
tttccgccatttgaggcgactcagcacgaaggacagttatacggacgcggctctgctgat
atgaaaggcagtttagccgctatgctagttgccactaaggcctttgttactaagcaccct
gaacatacgggatcgattgcttttcttattaccagtgacgaggaaggcccttttattaat
ggcaccactcgtgtgatcgacacccttgaagcccgcaacgagaaaatgacgtggtgctta
gtaggcgaaccatcaagcaccacacttgtaggagatgtagtaaaaaacggccgtcgtggt
tcacttaccggcgatatcgtcattaaaggggtgcaaggccatgttgcctatcctcaccta
gcgaaaaaccctattcatgcctcagcaccagcatttgctgagctcgctcagacccattgg
gacagtggcaatgcctcatttccccctaccagttttcaagtttctaatattaattcgggt
acgggggctggcaacgtcataccaggtgacctaactgcctgttttaatttccgtttttca
accgaagtgaccgacaagcaacttatcgaacgggttatctcaattcttgataagtacgac
tttgattacgaaattgattggaccttcaacggtcagccttttttaactgattcaggtaaa
ttagttgaagcgacccaagatgcgataaaagacgttaccggtagacagacagaactctcc
actgcaggtggcacgtccgacgggcgctttattgcaccaacgggagcgcaagtaatcgaa
ttaggccctgtaaacgcaactattcataaaatagacgaaaacgtaaacatcaaagattta
gccgaactcgctaaaatttaccaaggtattttacaaaggttattggcttga

DBGET integrated database retrieval system