KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2101Help
Entry
Glaag_2101        CDS       T01483                                 

Definition
alpha amylase catalytic subunit
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glaag_2101
Enzymes [BR:gag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Glaag_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2463701..2465476)
Genome map
AA seq 591 aa AA seqDB search
MNGEAMQSTYNQLTELVEHHLAVIYNDIELAQSYQEIASQLLDTMGFKEDVHMTPPLRHH
NNWTQEDAVLITYGDSIESPGEKPLSTLHTFLTNSCAKNINSVHILPFFPYSSDDGFSVI
DYSSVNESLGDWEDIKRIASDFRLMSDVVINHCSSRSAWFDNFIKGEGPGSDFFFTASPD
EDLSNVVRPRISPLLRETETAKGIEHVWCTFSHDQVDFDFRNPKVLQTFVSIIRQYLDNG
VRIFRLDAVAFLWKKMGTSCINLEQTHEAVRLLRTLIEYAQPDAIIITETNIPNRENLAY
LGNANEAHAIYNFSLPPLLVNALITGDCHYLKSWLMSMPPAQNGTTYFNFIASHDGIGLR
PAEGLLEDEELTVLVNTMQNFGGRISWRASENGQQKAYEINIALYDALQGTTKGTDKWGF
QRFMCAHAIMLGLEGIPGIYIHSLLATSNDYERVKNTSHNRAINRHKWQYDALQEQLESP
YSQHHRVLNAMGDLLTIRRQQVAFHPNATQFTLQLGSKIFGFWRQSIDRRQSIFCLSNIC
DETQEVHLSDINLVGTDEWIDLITKQPIYATDCSLELAPYQTMWISNLPKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgaagcaatgcaaagtacctataaccaattaactgagttagtcgaacatcac
ttggctgttatttataatgacatcgagttagctcaatcctatcaggaaatagcaagtcag
ttgctcgataccatgggctttaaagaagatgtgcacatgactcccccattgcgacatcac
aacaattggacccaagaagatgcagtactgataacctatggcgattcaatagaatcgccg
ggagaaaaaccactaagtacgcttcacacgtttttaaccaacagctgcgctaagaatata
aacagtgtgcatatattgccgtttttcccttacagttccgatgatggcttttcagtgatc
gattattcgagcgtgaatgaatcattaggcgactgggaagatattaagcgtatcgcttca
gacttcagattaatgtcagatgtcgtcattaatcactgttcatcacgaagtgcttggttc
gataatttcatcaagggtgaaggccctggcagtgacttcttcttcactgctagtccagat
gaagacttgtcgaatgtcgtccgccctcgcatctctccgttacttcgagaaacggaaacg
gccaaaggtattgaacacgtttggtgtacatttagtcacgatcaagttgattttgatttt
cgtaatcctaaagtgctgcaaacctttgtctctattattcgccagtatcttgataacggg
gtacgtattttcagattggacgccgtagcatttttatggaaaaaaatgggtacgagctgc
ataaacttggaacaaacccacgaagcagttcgattgctacgtacattaattgaatacgca
caacctgatgcaattatcattaccgagaccaatatccccaatcgcgagaaccttgcatac
ttgggaaatgcaaatgaagcacacgccatatacaatttctcgctcccgccgttattggta
aatgcactcattacgggtgactgtcattaccttaagtcttggttaatgagtatgccgccg
gcccaaaatggtacgacatattttaactttattgcctctcacgatggcattggtcttcgc
cctgctgaaggtttgttagaagatgaagaactcactgttttggttaatacaatgcaaaac
ttcggcggcagaatatcttggcgagcatcagaaaatgggcaacaaaaggcctatgaaatt
aacatcgccttatatgacgcgttgcaaggcaccaccaaagggacagacaagtggggattc
caacgcttcatgtgtgctcatgccattatgttgggtcttgaaggaataccaggcatttat
attcatagcttgttagccacaagcaacgattatgagcgcgtaaaaaacaccagtcataat
cgcgcgataaaccgccataagtggcaatatgatgcgttgcaagaacaactggaatcccct
tactcgcaacaccatcgagtattaaatgcaatgggtgacttacttactattcgtcgacag
caagtcgcttttcatccaaatgcgactcagtttaccttgcaattaggcagcaagatcttt
gggttttggcgccagagcatcgatagacgtcaaagtatattttgcctaagcaacatatgt
gatgagacacaagaagtgcatctaagtgatataaacttagtaggcactgatgaatggatc
gatctcatcacgaaacagcctatttatgcaacggattgcagcctagagctcgctccgtat
caaacgatgtggatcagcaacttacctaaacgatag

DBGET integrated database retrieval system