KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2122Help
Entry
Glaag_2122        CDS       T01483                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Glaag_2122
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Glaag_2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481789..2483747
Genome map
AA seq 652 aa AA seqDB search
MSIPNSDTLSIGVCDYPEHVPQNEWAEHAEQQKALGLTYVRLAEFSWAKIEPTDGVFDWQ
WLDDAIATYVAKGLKIVMCTPTATPPAWLVQKFPQILAIDAQGQTMKFGSRRHYDHACET
YRIECKRITTEIAKRYGQHADVIGWQTDNELGHEGTAVSYGGASAARFPKWLEARYQTLD
ALNEAWGCAFWSQDYSQWSQICPPNLTAVRQPNPSQVLDYQRFCSDMIDEFQQLQIEVLR
ALSPDRFITHNFVIFAEEFDLYKVAKNLDFVAWDSYPIGMLEFFATWESEETKTEFARTG
HPDLVSFNHDLYRGIKGGKDFWIMEQQCGHANWAQYNPLPAKGAVQLWSAQAWAHGASSV
TYFRWRASHMAQEIMHSGLLQQDGRADRGYQEVKDFDPSQFALEKVDAKVALLHDYNSLW
AYNVQPHNKDLNYWHQFMMFYTALRELGVDVDIIHPEQLADKQYALVVAPALTLMDEKTA
RVLTNQAQSTPIIFGPRTAFRHNSGRVANKGQFELIEDIVGIKLANFDSLRPTLEQAICC
ENTKTEYSATLWCESYEATSAVVTHTYTHGPMVGLPAVTQKDKVSVIGALSAGLISSVLI
EALSGAGITTYRLPKGLRLSRRGNTTLVQNFNQQAVEWQGITYPGVSFTRLK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtctataccaaatagcgacacattaagtattggcgtgtgtgattatcctgaacatgtg
ccccagaatgaatgggcggaacatgctgaacaacagaaagcgttaggcctaacatatgtt
cgtctggctgaattttcctgggctaaaattgaacctacagatggcgtatttgattggcag
tggctagatgatgcgattgcaacgtatgttgcaaaaggccttaagattgtaatgtgtacc
cccacagctacgcctcctgcttggttagtacaaaagtttccacaaattttagccattgat
gcccaaggccagaccatgaaatttggttcgcgccgtcactatgaccatgcctgtgaaacg
taccgcatagaatgcaaacgaattacaaccgagatagcgaagcgctatggtcaacatgct
gatgtgattggttggcagactgataatgagttaggtcatgaaggcactgcagtgtcttat
ggcggtgcgagcgcggcgcgttttcctaagtggcttgaagctcgttaccaaaccttggac
gcattaaacgaagcttggggctgcgccttttggagccaagattattcacaatggtcgcaa
atttgtccgccaaatttaacggctgttcgccagcccaacccgtcgcaggtattagattat
cagcgcttttgttcggacatgatagacgagtttcaacagctgcaaatagaggtgcttagg
gcgctgtcgccggatcggtttattacccacaatttcgttatttttgccgaagagtttgac
ctatacaaagtggccaaaaacttagattttgtcgcttgggatagctatccaatcggtatg
ctagagtttttcgctacttgggagagcgaggaaacaaaaacagaattcgcccgcactggt
caccccgacttggttagttttaatcacgatttatatcgcggcattaaaggtggtaaagat
ttttggataatggagcagcaatgcggtcacgctaattgggcgcagtacaatccgttaccc
gccaaaggtgcagttcagttgtggtccgctcaggcgtgggctcatggcgcaagttcagta
acttactttaggtggcgggcaagccacatggctcaagaaatcatgcattccgggttattg
cagcaagacggacgcgctgatcgcggttatcaagaagtgaaagactttgaccctagccaa
ttcgcacttgaaaaagtagatgcaaaagtcgcgctgttacacgattacaatagtctatgg
gcctacaacgtgcagcctcataataaagacttaaattactggcatcaatttatgatgttc
tacactgcattgcgcgaactaggggttgatgttgatattattcaccccgagcaattggca
gataaacaatatgcgctggttgttgcccccgctctaacgttaatggatgaaaaaacggcc
cgagtactgacaaaccaagctcaatcgacccctattatatttggcccgcgtacggctttt
cgtcataattcagggcgtgttgctaacaaagggcagttcgaattaatcgaagatatagtc
ggcattaaactggcaaactttgattcgcttcgtcctacattagaacaagcaatttgttgt
gaaaatacaaagacagagtatagcgcaacgctttggtgtgaaagttatgaagcaaccagt
gctgttgtgacgcatacctacacgcatgggcctatggttggtttgcctgcggtcacccaa
aaagacaaggtaagtgtcattggggcattatcagcagggttaattagcagcgtcttaatc
gaagcgttaagtggagcgggaataacaacttaccgtctacccaaaggcctaagacttagt
agacgaggcaataccacgctagtacagaactttaatcagcaagccgttgaatggcagggg
ataacgtaccctggcgtttcatttacaaggcttaagtaa

DBGET integrated database retrieval system