KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2147Help
Entry
Glaag_2147        CDS       T01483                                 

Definition
3-oxoacyl-ACP synthase II
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Glaag_2147
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Glaag_2147
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Glaag_2147
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     Glaag_2147
Lipid biosynthesis proteins [BR:gag01004]
 Fatty acid synthase
  Component type
   Glaag_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2509121..2510359
Genome map
AA seq 412 aa AA seqDB search
MAKRRVVVTGLGVLSPVGNDYTSTWQNIVEGKSGIGPITVFDASEYTTHFAGEVKDFNVE
DYIAKKETKKMDKFIQFGIAAGKQALADSGLVITEKNASRVGVAIGSGIGGLSLIEENHT
KLVNSGPKRISPFFVPATITNMISGFLSIMEGLKGPNLNIVTACTTGVHNMGIAARTIAY
GDADAMLAGGAEASICPLGLGGFAAARALSTRNDNPQIASRPWDKDRDGFVMGEGAGVVM
LEEYESAKARGAKIYAELVGFGMSGDAHHMTSPPENGEGAAAAMHNALNDASVNAQQVGY
INAHGTSTPAGDVAEVAAVKTIFEESAKKVLVSSTKSMTGHLLGAAGAVEAIFTILALKD
QIAPPTINLDNPGEGCDLDFVANEARSIKMDYALCNSFGFGGTNGSLLFKKV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaacgtcgggttgtagtaaccggtcttggcgtactctctcctgtgggcaatgat
tatacatccacgtggcagaatatcgtcgaaggtaaaagtggtataggtcctatcacagtg
tttgatgcatctgaatacacgacgcatttcgcaggcgaagttaaagacttcaacgttgaa
gactacattgccaagaaagaaaccaagaaaatggataaatttatccagtttggtattgcc
gctggcaagcaggcattagcggattcaggattagtgatcaccgaaaagaacgcatcgcgt
gttggtgttgccattggttcaggtattggcggattaagtttgattgaagaaaatcacact
aaattagttaattcgggccctaagcgtatctcaccctttttcgtacctgctaccatcaca
aatatgatttcaggcttcctgtccatcatggaaggtttgaaaggacctaatttaaacatt
gtgactgcctgtaccacaggtgtgcataatatgggtatcgcggcgcgtactattgcctac
ggtgatgccgacgctatgttggcaggcggtgcggaagcgtctatttgtcctttgggctta
ggtggcttcgcagcggcacgagcgctatcgacacgaaatgacaacccacaaatcgccagt
cgcccatgggataaagaccgagatggttttgtaatgggtgaaggtgcgggtgttgttatg
ctcgaagagtacgaatcagctaaagcgcgtggtgcgaaaatctacgcagaacttgttggt
ttcggaatgagcggtgacgcacatcatatgacctctccaccagaaaatggcgaaggcgct
gctgcagcgatgcacaatgcattgaatgatgcatctgttaatgcacagcaagtgggctac
atcaatgcgcacggaacctctaccccagcgggtgatgttgctgaagttgcagcggtgaaa
accatctttgaagaaagtgccaagaaggtattggttagctcaacaaaatcaatgacaggc
caccttttgggtgccgctggtgcagttgaagcgattttcactattttggcgttaaaagat
caaatagccccaccgacaattaatttagataacccaggtgaagggtgcgatctggatttt
gtcgcgaacgaagcacgttcaattaaaatggattacgctctgtgtaactcatttggattt
ggtggcactaacggatcgttactcttcaaaaaagtgtaa

DBGET integrated database retrieval system