KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2147Help
Entry
Glaag_2147        CDS       T01483                                 

Definition
3-oxoacyl-ACP synthase II
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gag01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:gag00061]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:gag00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2509121..2510359
Genome map
AA seq 412 aa AA seqDB search
MAKRRVVVTGLGVLSPVGNDYTSTWQNIVEGKSGIGPITVFDASEYTTHFAGEVKDFNVE
DYIAKKETKKMDKFIQFGIAAGKQALADSGLVITEKNASRVGVAIGSGIGGLSLIEENHT
KLVNSGPKRISPFFVPATITNMISGFLSIMEGLKGPNLNIVTACTTGVHNMGIAARTIAY
GDADAMLAGGAEASICPLGLGGFAAARALSTRNDNPQIASRPWDKDRDGFVMGEGAGVVM
LEEYESAKARGAKIYAELVGFGMSGDAHHMTSPPENGEGAAAAMHNALNDASVNAQQVGY
INAHGTSTPAGDVAEVAAVKTIFEESAKKVLVSSTKSMTGHLLGAAGAVEAIFTILALKD
QIAPPTINLDNPGEGCDLDFVANEARSIKMDYALCNSFGFGGTNGSLLFKKV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaacgtcgggttgtagtaaccggtcttggcgtactctctcctgtgggcaatgat
tatacatccacgtggcagaatatcgtcgaaggtaaaagtggtataggtcctatcacagtg
tttgatgcatctgaatacacgacgcatttcgcaggcgaagttaaagacttcaacgttgaa
gactacattgccaagaaagaaaccaagaaaatggataaatttatccagtttggtattgcc
gctggcaagcaggcattagcggattcaggattagtgatcaccgaaaagaacgcatcgcgt
gttggtgttgccattggttcaggtattggcggattaagtttgattgaagaaaatcacact
aaattagttaattcgggccctaagcgtatctcaccctttttcgtacctgctaccatcaca
aatatgatttcaggcttcctgtccatcatggaaggtttgaaaggacctaatttaaacatt
gtgactgcctgtaccacaggtgtgcataatatgggtatcgcggcgcgtactattgcctac
ggtgatgccgacgctatgttggcaggcggtgcggaagcgtctatttgtcctttgggctta
ggtggcttcgcagcggcacgagcgctatcgacacgaaatgacaacccacaaatcgccagt
cgcccatgggataaagaccgagatggttttgtaatgggtgaaggtgcgggtgttgttatg
ctcgaagagtacgaatcagctaaagcgcgtggtgcgaaaatctacgcagaacttgttggt
ttcggaatgagcggtgacgcacatcatatgacctctccaccagaaaatggcgaaggcgct
gctgcagcgatgcacaatgcattgaatgatgcatctgttaatgcacagcaagtgggctac
atcaatgcgcacggaacctctaccccagcgggtgatgttgctgaagttgcagcggtgaaa
accatctttgaagaaagtgccaagaaggtattggttagctcaacaaaatcaatgacaggc
caccttttgggtgccgctggtgcagttgaagcgattttcactattttggcgttaaaagat
caaatagccccaccgacaattaatttagataacccaggtgaagggtgcgatctggatttt
gtcgcgaacgaagcacgttcaattaaaatggattacgctctgtgtaactcatttggattt
ggtggcactaacggatcgttactcttcaaaaaagtgtaa

DBGET integrated database retrieval system