KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2154Help
Entry
Glaag_2154        CDS       T01483                                 

Definition
alpha amylase catalytic subunit
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Glaag_2154
Enzymes [BR:gag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Glaag_2154
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2515719..2517521
Genome map
AA seq 600 aa AA seqDB search
MPNEKHLPMGISKLDKGYAVSVWAPNAVNVSIRGEFDDWSDEGVVLSKEEGGIWAGHVPS
LANSQQYQFSITSESGDVLKRNDPRARLLTNSVGASIVYDDDYEWPLDSFSMPDKKSLVI
YELHIGTFNCKDRDDNGVANKPGTFHSTIEKLDYLVELGINCIEVMPVNEFAGDFSWGYN
PAYPFAVEEAYGGPNGLKDLVREAHARGIAVVLDVVYNHFGPSDLHLWQFDGWSENEKGG
IYFYNDWRSDTPWGDTRPDYGREEVRQYIFDNAMMWLDEYRLDGLRMDMIPYMRSVSGSE
NPADSIEEAYELIRWINSEVQRRHPEKIIVAEDLHGNDFVTNSTEEGGLGYTAQWDADFV
HPIRDVLTQPEDDSRDIAIVEKALMRLYSDDAFCRVIYVESHDEVANGSARLAEEIAPGN
VDKDYFARQRSVIAAALTLTAPGIPMLFQGQELLEDLWFDDKDPIDWKRNQKFPQLQQAY
QTLIALRKQCPSLQSHDIKVTHFDQENGVLAYTRGKDVSDESSSGTNDKVMVLINFKNQT
HENYEVPALNSEQWQCVFNWYGGYHDPHAFSGCENGNNGNDPKLVLNLENYQVLIFQLGH
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacgaaaaacaccttcctatgggaataagcaagttagacaaaggttatgccgta
tctgtttgggcacccaatgccgttaacgtttcgatacgtggggaatttgacgattggagc
gacgaaggtgttgtcctgtctaaagaggaaggaggtatatgggccggacacgtgcccagt
ctagccaatagccaacaatatcaatttagcattaccagcgaatctggtgatgtattaaag
cgaaatgatccaagagctcgcttgcttaccaacagtgttggcgcctcaattgtttacgat
gacgactatgagtggccactagactctttttcgatgcccgacaaaaagtcgctggttatt
tacgaactgcatatcggcacatttaactgcaaagatcgagacgacaatggcgtggcgaat
aaaccaggcacgtttcacagtactatcgaaaaactagattatcttgtcgagctaggcatc
aattgtattgaagtaatgcccgttaatgaatttgctggcgactttagttggggctacaac
cctgcttatccatttgcggttgaagaagcatatggtggcccaaatggtctaaaagatttg
gttcgcgaagcccatgctcgaggcatagccgttgtgctagatgtggtttataaccatttt
ggaccgagcgaccttcacctttggcaattcgatggttggtctgaaaacgaaaaaggggga
atttatttttataatgattggcgaagtgacacaccttggggcgacacaagacctgattat
ggtcgcgaggaggtgcgtcagtatatattcgacaatgcgatgatgtggttagacgaatat
aggctagatggtctgcgtatggatatgatcccatacatgcgctcggtatcgggctcagag
aaccctgccgatagcattgaagaggcttatgaattaattcgctggatcaatagcgaagtt
cagcgccgtcaccctgaaaaaatcattgtcgccgaagatctgcatggaaacgactttgta
actaatagcaccgaggaaggtggcctcggttacactgcacagtgggatgcggactttgtc
catccgatacgagacgtattaacacaacctgaagacgacagtagagatatagcaatcgtt
gaaaaagcccttatgcgactttactccgacgacgctttttgccgtgtgatttacgtcgaa
tcacacgatgaggtggcaaatggcagtgctcgattagcagaagaaattgcccctggtaac
gtggataaagactattttgcacgtcagcgttcagttatagctgctgcgctcacgctaacc
gcaccaggtattcctatgttgtttcaaggtcaagagttgctagaagatctatggtttgat
gataaagacccaatagactggaagcggaatcagaagtttccccaattacaacaagcttac
caaacacttatcgcgttgcgtaaacagtgtcccagtttacaaagccatgacatcaaggtg
actcactttgatcaggaaaatggcgtattggcctatacccgaggtaaagatgtcagtgat
gagtcatctagtggcacgaacgacaaggttatggtgctcatcaatttcaaaaaccaaacg
catgaaaactatgaggtccccgctttaaacagtgagcaatggcagtgtgtttttaattgg
tatgggggctatcacgacccgcatgctttttcaggttgtgagaatggaaataacggaaat
gatccaaaattagtgctcaatctcgaaaattatcaggttttaatttttcagctgggccac
taa

DBGET integrated database retrieval system