KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2174Help
Entry
Glaag_2174        CDS       T01483                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_2174
   00030 Pentose phosphate pathway
    Glaag_2174
   00051 Fructose and mannose metabolism
    Glaag_2174
   00052 Galactose metabolism
    Glaag_2174
  Energy metabolism
   00680 Methane metabolism
    Glaag_2174
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Glaag_2174
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Glaag_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2542946..2544091
Genome map
AA seq 381 aa AA seqDB search
MASISSPDQSHEPTNKPSRVAILTGGGDCPGLNAAIRGVAKTLMLRAQTEIIGIEDGFLG
FIERRSRTLTYQDCSGILSLGGTMIGTHNRANPFDYMGEDRSGAVKEYYDELALDALVII
GGDGTLSIGYELTKLGMNIVGVPKTIDNDLMCTERTFGFDTAVSIVTDAIDRLRTTGQSH
QRIMIVETMGRNAGWIALHAGIAGGADSILLPEHPYDINLVADACNQRMGTHHFSIVVVA
EGAKPINGEVCTRETIKDSPEPTRLGGIGDQLKQQLEQLTDAEIRSTTLGHIQRGGSPTS
FDRIFATNLGSYAAGLVINKQFNLAVIQRGNQLSEVPLDSVAHKTRNIPNDDPTLQTALS
MGICFGTETLLRSGAKLNEPE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatatcttcacctgatcaatcgcatgaaccaacaaataagccctcacgcgtc
gcaatattaacagggggtggagactgtcctggcttgaacgctgccatcagaggggtagcg
aaaacccttatgttaagagcccagacagaaataatcggtatcgaagacggctttttaggc
tttattgagcgacgttcacgcacacttacctatcaagactgcagcggtatcttatcgtta
ggtggcaccatgataggcactcataaccgtgccaacccatttgattacatgggagaagat
cgttcaggggccgtgaaagaatactacgatgaactagcccttgatgcgctcgttatcatt
ggtggtgacggtacgttaagtattggttatgaattaacgaagttgggtatgaacatagtt
ggagtgcccaaaaccatagataacgatttaatgtgtaccgaacggacatttggtttcgat
acggccgttagtattgttactgacgccattgatcgtttgcgcaccacagggcaatctcat
caacgcatcatgattgtcgaaaccatgggaagaaatgccggttggatcgcccttcatgcg
ggtatagctggaggcgctgacagtattttattacctgagcacccttacgatattaattta
gtggctgatgcctgtaatcaacgaatgggtacccatcatttttcgattgtcgtggtcgca
gaaggtgcaaaaccgataaacggtgaggtgtgtacacgagaaacgataaaagatagtcca
gaacctacgcgtcttggcggtattggcgatcagttaaagcaacagttagagcaactcaca
gatgctgagatccgttccactacattaggccacatacagcgaggaggctctcctacctca
tttgatagaattttcgcgaccaacttaggcagctatgcagcaggattagttatcaataaa
cagtttaaccttgccgttattcagcgcggaaaccaattgtctgaagtgcccctagacagt
gtcgcccataagacccgcaatatccccaatgatgaccccacgttgcaaacggctttatca
atgggcatatgttttggaacagaaacattattacgaagtggagctaaattgaatgagcct
gaataa

DBGET integrated database retrieval system