KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2174Help
Entry
Glaag_2174        CDS       T01483                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:gag01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gag01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gag00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gag00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gag00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gag00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:gag00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2542946..2544091
Genome map
AA seq 381 aa AA seqDB search
MASISSPDQSHEPTNKPSRVAILTGGGDCPGLNAAIRGVAKTLMLRAQTEIIGIEDGFLG
FIERRSRTLTYQDCSGILSLGGTMIGTHNRANPFDYMGEDRSGAVKEYYDELALDALVII
GGDGTLSIGYELTKLGMNIVGVPKTIDNDLMCTERTFGFDTAVSIVTDAIDRLRTTGQSH
QRIMIVETMGRNAGWIALHAGIAGGADSILLPEHPYDINLVADACNQRMGTHHFSIVVVA
EGAKPINGEVCTRETIKDSPEPTRLGGIGDQLKQQLEQLTDAEIRSTTLGHIQRGGSPTS
FDRIFATNLGSYAAGLVINKQFNLAVIQRGNQLSEVPLDSVAHKTRNIPNDDPTLQTALS
MGICFGTETLLRSGAKLNEPE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatatcttcacctgatcaatcgcatgaaccaacaaataagccctcacgcgtc
gcaatattaacagggggtggagactgtcctggcttgaacgctgccatcagaggggtagcg
aaaacccttatgttaagagcccagacagaaataatcggtatcgaagacggctttttaggc
tttattgagcgacgttcacgcacacttacctatcaagactgcagcggtatcttatcgtta
ggtggcaccatgataggcactcataaccgtgccaacccatttgattacatgggagaagat
cgttcaggggccgtgaaagaatactacgatgaactagcccttgatgcgctcgttatcatt
ggtggtgacggtacgttaagtattggttatgaattaacgaagttgggtatgaacatagtt
ggagtgcccaaaaccatagataacgatttaatgtgtaccgaacggacatttggtttcgat
acggccgttagtattgttactgacgccattgatcgtttgcgcaccacagggcaatctcat
caacgcatcatgattgtcgaaaccatgggaagaaatgccggttggatcgcccttcatgcg
ggtatagctggaggcgctgacagtattttattacctgagcacccttacgatattaattta
gtggctgatgcctgtaatcaacgaatgggtacccatcatttttcgattgtcgtggtcgca
gaaggtgcaaaaccgataaacggtgaggtgtgtacacgagaaacgataaaagatagtcca
gaacctacgcgtcttggcggtattggcgatcagttaaagcaacagttagagcaactcaca
gatgctgagatccgttccactacattaggccacatacagcgaggaggctctcctacctca
tttgatagaattttcgcgaccaacttaggcagctatgcagcaggattagttatcaataaa
cagtttaaccttgccgttattcagcgcggaaaccaattgtctgaagtgcccctagacagt
gtcgcccataagacccgcaatatccccaatgatgaccccacgttgcaaacggctttatca
atgggcatatgttttggaacagaaacattattacgaagtggagctaaattgaatgagcct
gaataa

DBGET integrated database retrieval system