KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2174Help
Entry
Glaag_2174        CDS       T01483                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_2174
   01230 Biosynthesis of amino acids
    Glaag_2174
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Glaag_2174
   00030 Pentose phosphate pathway
    Glaag_2174
   00051 Fructose and mannose metabolism
    Glaag_2174
   00052 Galactose metabolism
    Glaag_2174
  Energy metabolism
   00680 Methane metabolism
    Glaag_2174
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Glaag_2174
Protein phosphatases and associated proteins [BR:gag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Glaag_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2542946..2544091
Genome map
AA seq 381 aa AA seqDB search
MASISSPDQSHEPTNKPSRVAILTGGGDCPGLNAAIRGVAKTLMLRAQTEIIGIEDGFLG
FIERRSRTLTYQDCSGILSLGGTMIGTHNRANPFDYMGEDRSGAVKEYYDELALDALVII
GGDGTLSIGYELTKLGMNIVGVPKTIDNDLMCTERTFGFDTAVSIVTDAIDRLRTTGQSH
QRIMIVETMGRNAGWIALHAGIAGGADSILLPEHPYDINLVADACNQRMGTHHFSIVVVA
EGAKPINGEVCTRETIKDSPEPTRLGGIGDQLKQQLEQLTDAEIRSTTLGHIQRGGSPTS
FDRIFATNLGSYAAGLVINKQFNLAVIQRGNQLSEVPLDSVAHKTRNIPNDDPTLQTALS
MGICFGTETLLRSGAKLNEPE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatatcttcacctgatcaatcgcatgaaccaacaaataagccctcacgcgtc
gcaatattaacagggggtggagactgtcctggcttgaacgctgccatcagaggggtagcg
aaaacccttatgttaagagcccagacagaaataatcggtatcgaagacggctttttaggc
tttattgagcgacgttcacgcacacttacctatcaagactgcagcggtatcttatcgtta
ggtggcaccatgataggcactcataaccgtgccaacccatttgattacatgggagaagat
cgttcaggggccgtgaaagaatactacgatgaactagcccttgatgcgctcgttatcatt
ggtggtgacggtacgttaagtattggttatgaattaacgaagttgggtatgaacatagtt
ggagtgcccaaaaccatagataacgatttaatgtgtaccgaacggacatttggtttcgat
acggccgttagtattgttactgacgccattgatcgtttgcgcaccacagggcaatctcat
caacgcatcatgattgtcgaaaccatgggaagaaatgccggttggatcgcccttcatgcg
ggtatagctggaggcgctgacagtattttattacctgagcacccttacgatattaattta
gtggctgatgcctgtaatcaacgaatgggtacccatcatttttcgattgtcgtggtcgca
gaaggtgcaaaaccgataaacggtgaggtgtgtacacgagaaacgataaaagatagtcca
gaacctacgcgtcttggcggtattggcgatcagttaaagcaacagttagagcaactcaca
gatgctgagatccgttccactacattaggccacatacagcgaggaggctctcctacctca
tttgatagaattttcgcgaccaacttaggcagctatgcagcaggattagttatcaataaa
cagtttaaccttgccgttattcagcgcggaaaccaattgtctgaagtgcccctagacagt
gtcgcccataagacccgcaatatccccaatgatgaccccacgttgcaaacggctttatca
atgggcatatgttttggaacagaaacattattacgaagtggagctaaattgaatgagcct
gaataa

DBGET integrated database retrieval system