KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2527Help
Entry
Glaag_2527        CDS       T01483                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gag00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2968758..2970647)
Genome map
AA seq 629 aa AA seqDB search
MCGITGLFRLNTSSCKANIIQKMNTTLNHRGPDDNGVWEGSPGVALGHCRLAVQDLSQDG
HQPMHSACDRYVMVFNGEVYNFAEIRQSLSQQSFKGHSDSEVVLCAIAEFGLKAALRKFN
GMFALAIWDKQQKTLSLARDRVGKKPLYFGRSNDYFCFSSELKALKVIPDFTPELDMQAL
GQYMRFNYIPAPYSIYQGIYKLAPGSFVTLTVDELSSEHDLLDKCQQYWSALDVAAHQFN
HPFSGTLDEAQTHLTHLLEDSTRLRMISDVPFGVLLSGGIDSSLVASMMQKQSARPVNSF
SIGFSHSDKDEAHLAKNIAGYLGTSHNELYVSGQDALDLVPDIAQHYDEPFADSSQIPTF
IVAKLAKSKVTVALSGDGGDELFYGYNRYFRNIKNWQISQKIPDALKRAVSGQLFRLASI
QKLGLTTNKYANEIGAMNVLDMYMSRVCKWVAPENLMLQPHTPEQHKLRAVSALDLPRPE
HYLMLYDYVTYLCDDILVKTDRASMANSLELRSPLLDHRITEFAWSLPMSMKFHEGKGKH
VLRKVLDQHIPNSLTNNPKHGFGAPIKSWLNGPLNDWAEDLLTQDKIEQQGIFDSEKVAL
LWHDFKHKKKKYHTQLWNMLMFQSWYHNQ
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcacaggtctttttcgcctcaatacttcttcttgcaaagcgaatattatt
caaaaaatgaatacgactttgaatcaccgcggtccggacgacaacggtgtttgggaaggt
agtcctggggtggcgttgggccattgtcgattggcggtacaagatttaagtcaggatggc
catcaaccaatgcattcagcgtgtgatcgttatgtgatggtatttaatggtgaagtatac
aactttgctgaaatccgccagtccctctctcagcaatcattcaaagggcattcagatagc
gaagttgtgctctgtgcgattgccgaattcggtttaaaggcagcattacgcaaatttaac
ggtatgtttgcgctggcgatatgggataaacaacaaaagaccttgtcgttagctagggat
cgcgtaggtaaaaaaccgctttattttggacgcagcaatgattatttttgtttttcttct
gagctaaaagcgttaaaggtcatccctgactttaccccagaattggacatgcaggccctt
gggcaatatatgcgctttaattatattcctgccccgtactccatttaccaaggaatatac
aaattagcacccggcagttttgtgaccctaacggttgatgaattgtcgtctgagcatgat
ttactcgataaatgtcaacaatattggtcggcgcttgatgttgctgcgcaccaatttaac
catccattttcgggcactttagatgaagcgcaaacgcatttaacgcatttattagaggat
tctactcgcttacggatgatttctgatgtgccgttcggggtgctattgtcaggtggcata
gactcaagtttggtcgcgtcgatgatgcaaaaacagtctgctcgccctgttaatagtttc
tccatagggtttagtcatagcgacaaagacgaagcgcatttagccaaaaatatcgcaggt
tatttgggcacatcgcacaatgagctgtatgtgagcggccaagatgcacttgatttggta
cctgatattgcccagcattacgacgagcccttcgctgattcctcacaaatacctacgttt
atcgttgctaaattagccaaaagtaaagtcacagttgcattaagtggggatggaggagat
gagctgttttacggttacaaccgttattttagaaacattaagaactggcaaatcagtcaa
aaaatacctgatgcgcttaagcgcgcagtttcgggtcaactgtttaggttagcgtcgata
cagaagttaggattgacgacgaataaatacgctaacgagataggcgcgatgaatgtactc
gatatgtacatgagccgtgtttgtaagtgggttgcccctgagaaccttatgctacagcct
catacaccggagcaacataaattgcgcgcggtaagcgcgttagacttacctcgccctgaa
cactatttaatgctttatgattatgtcacttatttgtgtgacgatattttagtcaaaacg
gaccgagcgagcatggcaaatagtctggagctaagaagccctttacttgatcaccgtatc
accgaattcgcttggtctcttcctatgtcgatgaagtttcatgaaggcaaaggaaagcat
gttcttcgaaaagtactagaccagcacattcctaactcgttgaccaataaccctaagcac
ggatttggcgcgccaataaaaagctggcttaatggcccattgaatgactgggcagaagat
ttacttacccaagataaaattgagcaacaaggtatttttgatagtgaaaaagtggcgcta
ctatggcatgacttcaagcacaaaaagaaaaaatatcatacacaactgtggaatatgttg
atgtttcaaagctggtaccacaatcagtaa

DBGET integrated database retrieval system