KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2613Help
Entry
Glaag_2613        CDS       T01483                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Glaag_2613
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Glaag_2613
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Glaag_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3059362..3060363)
Genome map
AA seq 333 aa AA seqDB search
MLDVTGCELTPDDKELLDHPLVGGVILFSRNYYDQKQLAQLIAQIRLAARNQVLIGVDHE
GGRVQRFRDGFSAIPAMGAIYQQSAEDLTKAQHYCKTFGWLMAAECLAFDIDLSFAPVLD
LNGVSDVIGDRSFHSQPEPLIQMASAFIKGMHSAGMKATGKHFPGHGNVKEDSHIAMPVD
KRSLEQITQLDMQVFTRLNEMGLLDGVMPAHVVYPDVDDMPAGFSKVWLQTYLRKKMQFE
GVIFSDDLSMQGAAFIGNFAARASAALNAGCDMVLVCNNPDAAVQVIDSLPSNLPDNPRL
AKLVKAPSADFRALAKTGDYASALRTLEAYYNQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtcacaggttgtgaattaacacctgatgacaaagaactgctcgaccatccg
ctggtgggcggggttattttattcagccgtaactattatgatcaaaagcaacttgcccag
ctcattgctcaaattcgtttagctgcacgaaaccaggtgttaattggtgtcgatcatgag
ggcgggcgagtacaacgttttcgtgatggtttcagtgccattcctgcaatgggggctatt
taccagcaaagcgctgaagatttaaccaaagcccaacattactgcaaaacctttggttgg
cttatggcagctgagtgtttggcatttgatattgatctgagttttgcgcccgtattggac
ttaaacggtgtgtcggacgtgataggtgatcgttcttttcattcccagccagagccattg
attcagatggctagtgcgtttattaaagggatgcacagtgctggcatgaaagccacaggc
aaacactttccgggacatggtaatgtgaaagaagactcgcacatagccatgccagtcgat
aagcgtagcctcgaacaaatcacccaattggatatgcaggtttttacccgcttaaacgaa
atgggattactcgatggggtgatgcctgcacatgttgtttacccagatgtggatgacatg
cctgcagggttttctaaagtgtggcttcaaacctacctacgcaagaaaatgcaatttgaa
ggcgtgatcttttcagatgatttatcaatgcaaggggcggcatttattggaaactttgcc
gccagagcaagcgcagcattaaatgccggatgtgacatggtgttggtgtgcaataatccg
gatgctgccgttcaggttatcgacagtttaccgagtaatttaccggataatccgcgctta
gcgaaattagttaaggcacccagtgctgattttagagcgcttgctaaaacaggcgattac
gcaagtgcgctgcgtacacttgaagcgtattacaatcaataa

DBGET integrated database retrieval system