KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2757Help
Entry
Glaag_2757        CDS       T01483                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00790  Folate biosynthesis
gag01100  Metabolic pathways
Module
gag_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Glaag_2757
Enzymes [BR:gag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Glaag_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEE23696
UniProt: F4AKK1
Position
complement(3224095..3224928)
Genome map
AA seq 277 aa AA seqDB search
MNFLHTILNLDSPKVMGILNVTPDSFSDGGRFSTISNAINHAEEMITSGADFIDVGGEST
RPGADDVTEQEELDRVVPVIEALHARFDTVISIDTSKPAVMKAAVDAGAGLINDVRALQE
PGALEVAAHAQVAVCLMHMRGQPRSMQDAPHYDDVQTDVHDFLHARAQACIQAGIHKDQI
LIDPGFGFGKSLAHNYQLLAQLEALHLLGYPLLVGMSRKSMIGQLLNRTTDERLAGSVAL
ATIAALKGAQIIRVHDVKETVDAVKIVSMLQKENNNE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcttcatacaatactaaatttggatagccccaaggtcatggggatcctcaat
gtcacgcctgattcattttcagatggcggacgcttctcaaccattagtaatgctattaat
cacgccgaagaaatgattacatcaggcgccgattttattgacgtaggtggagagtccacg
cgccctggtgctgacgatgtcactgagcaggaggagctcgacagagtcgtgcccgttatt
gaggcccttcatgcccgctttgatacggtaatctctatcgataccagtaagcctgccgtg
atgaaagctgcggtagatgcaggggcagggcttattaatgacgttagagcgctgcaggag
ccaggggcattagaagtagccgctcatgcacaggtagcagtgtgtttaatgcatatgcgt
ggtcaaccgcgtagcatgcaggatgctcctcattacgatgatgtacagactgacgtgcat
gactttttgcatgctcgagcgcaagcgtgtattcaagcgggtattcacaaagatcaaatt
ttgatagatccaggctttggatttggaaaaagtttagcgcataattatcagttgcttgcg
cagttagaagcgttacacctattgggctacccattacttgttgggatgtcgagaaagtca
atgataggccagttgctaaaccgaaccacggatgagcgactagcagggagcgtagcattg
gcgacgattgcagcgcttaaaggcgcgcaaatcatacgtgtacatgatgtaaaagaaaca
gttgatgcagtcaaaattgtgtctatgttacaaaaggaaaataataatgagtga

DBGET integrated database retrieval system