KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2908Help
Entry
Glaag_2908        CDS       T01483                                 

Definition
Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Glaag_2908
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Glaag_2908
Enzymes [BR:gag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Glaag_2908
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Glaag_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3377423..3378829
Genome map
AA seq 468 aa AA seqDB search
MANVLEKIVADKRQEIAQRKVDFPLAHFKDGLTPSTRSFFDALNQPNAGYILECKKASPS
KGLIRDDFNLDEIIEAYLPYAACISVLTDEKYFQGKFEYLEYVRERVTQPVINKDFFVEP
YQVYLARHHNADAILLMLSVLNDEEYRELADIAHSLDLDVLTEVSNEEEAHRAVALKANI
IGINNRNLRDLSTDLATTEHLVPLINQASHEHVIISESGIYTHQDVRRLSPFVDGFLVGS
ALMAEDNVAQAVKRLVYGTVKVCGMTRAKDATDVATMGASYAGLIFAEKSKRYLSLDDAR
DIVAAVPFDYVGVFVDANIALIVEYATTLGLVAVQLHGSESQSYITQLRAALNDANLAGC
QIWLAKGITDTLPALDEDGVDRFVLDCKVGDQSGGTGQAFDWQLFAQVDLSALSRSKIIL
AGGINVDNAQQAAGLGLGGIDLNSGVEDAPGKKSEQKLQRVFEKLRAY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtattagaaaaaattgttgccgataagcgtcaagaaatagcccagcgtaaa
gtggatttccctttagcgcactttaaagatggtcttacgccttcaacgcgtagctttttt
gatgcgctcaatcagcccaatgctggctacattttagagtgtaaaaaagcctctccgtca
aaaggtttgatcagagacgatttcaatttagatgagatcatcgaagcctacttaccttac
gctgcgtgcatctcggtgttgaccgatgaaaagtactttcaaggtaagttcgaatattta
gaatatgtcagagaacgtgtgacccagccggtgatcaacaaagactttttcgttgaaccc
taccaagtttacttggctcgtcatcacaacgctgatgccatcttattgatgttatcagtg
cttaatgacgaagagtatcgcgaattagccgatatcgcccacagccttgaccttgatgta
ttaacagaagtgagcaacgaagaagaggcgcatcgcgcagttgcgcttaaggccaatatt
atcggtatcaacaaccgcaatttacgagatttaagtaccgatttagccaccactgagcac
ttggtcccgttaattaatcaagcgtctcacgaacatgtgattatttctgaatccggtatt
tatacccatcaagatgtacgtcgcttgtcccctttcgttgatgggtttcttgtgggtagt
gcattaatggctgaggataatgtagcccaagcggtgaagcgtttagtctacggtacggtc
aaagtgtgcggcatgacccgcgctaaagacgccaccgacgtagcgactatgggtgccagt
tacgcagggcttatattcgctgaaaaatcaaaacgttacttatcacttgatgacgcaaga
gacatagtggcggctgtaccttttgattatgtaggcgtattcgttgacgccaatattgca
ttgatcgttgaatatgccaccacccttggtttagttgctgtgcaattacatggtagcgaa
tcacagtcctatattactcaattgcgcgcagcacttaacgacgcgaatttagctggttgt
caaatctggttagctaaggggatcactgataccctacccgcccttgatgaagacggcgtt
gatcgtttcgtgctggattgcaaagtaggcgatcaaagtggcggtactggtcaagccttt
gattggcaactgttcgcacaggttgatctaagtgctctaagtcgcagcaaaattattctg
gccggtggcatcaacgtagacaacgcacagcaagccgctgggcttggcctaggcggaatt
gatttaaactcaggcgttgaagacgccccaggcaaaaaatctgagcaaaagctgcaacgc
gtgttcgaaaaattacgcgcgtattag

DBGET integrated database retrieval system