KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3148Help
Entry
Glaag_3148        CDS       T01483                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00900  Terpenoid backbone biosynthesis
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Glaag_3148
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Glaag_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP NAD_binding_3 Epimerase NmrA Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AEE24082
UniProt: F4APR6
Position
complement(3676811..3678004)
Genome map
AA seq 397 aa AA seqDB search
MQNICILGATGSIGQSTLDVVLRHPSEYRVFAITAHSQIDKLIEQARLCQPKYVVLSDTR
AYQQAKQALIDAEIKAELLTGAEALADVASADEVDVVMAAIVGGAGLLPTIAAVKAGKKV
LLANKESLVMSGELFINAAKEHSATILPIDSEHNAIFQCLPHNYQYGDLSASGISSILLT
GSGGPFRETPLTSLCDMTPAEACAHPNWDMGQKISVDSATMMNKGLEFIEARWLFGLQSS
DIKVVLHPQSIIHSMVQYCDGSVLAQMGNPDMRTPIAHGLAFPKRIDSGVEPLDFQTVSQ
FSFGEPEQARYPNLYLAIEASNAGQYATTALNAANEVAVAAFLAGQIGFTQIAQVNQECL
AQMAGCQLNDIEAVVAWDQECRSKAQQLTSSYSREAS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatttgtatattaggggccacagggtcaattggacaaagtacgcttgatgtg
gtgttgcgtcaccccagcgaataccgcgttttcgcaataactgcccatagtcagatagac
aagctcattgagcaagcaaggttgtgtcagcctaaatatgttgtgttgtctgatacgcgg
gcttatcagcaagctaaacaagcccttattgacgccgaaataaaagccgagttgttaacc
ggtgctgaagccttagccgatgtggctagtgccgatgaggtggacgttgttatggcggcg
attgtgggcggggcaggtcttctacctacgattgcagcggtcaaagcgggtaaaaaagta
ttactagcgaacaaagaatccttagtgatgtccggcgagttgtttattaacgcagccaaa
gagcacagcgctacgattctgcctattgatagtgagcacaatgcaatctttcaatgtcta
cctcacaattatcagtatggcgatttaagcgcgagtggcatcagcagtattttattgacc
ggttcgggcgggccgtttcgtgaaacgccattaacctcattatgtgatatgacgcctgct
gaagcatgtgctcatcctaattgggatatggggcaaaaaatatcggtcgattcagccact
atgatgaacaagggcttagagtttattgaagcccgttggttatttggcctgcaaagtagt
gatataaaagtggtattgcacccacaaagtattatccattccatggtgcaatactgtgac
ggttcggtattggcccagatgggtaatcctgacatgcgaacgcccattgctcatggtctt
gcatttcccaagcgaatcgattctggtgtggaaccactagattttcaaaccgttagccag
tttagttttggcgaacctgagcaagcacgttaccccaatttatatttagccatcgaggca
tcaaatgctggtcaatacgccacaacggcattgaatgcggccaatgaagtggccgtggcg
gcttttttagctggtcaaattggcttcactcaaattgctcaagttaatcaagagtgccta
gcacaaatggccggttgtcagcttaatgatattgaagcggtcgttgcttgggatcaggaa
tgtcgtagcaaagcacagcagctcacttcatcttattcacgagaggcaagctga

DBGET integrated database retrieval system