KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3189Help
Entry
Glaag_3189        CDS       T01483                                 

Definition
isocitrate lyase and phosphorylmutase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_3189
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Glaag_3189
Enzymes [BR:gag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Glaag_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3715311..3716912
Genome map
AA seq 533 aa AA seqDB search
MSNYTNDIQAAQTLTGENSQTWNAINPEYVARMKAQNRFKTGLDIAKYTAGIMRKDMADY
DNDSSSYTQSLGCWHGFIGQQKMLAIKKHHGTTDKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVPALIEELYTFLRQADAKELGELFTALDKAKEAGESTQEIQDKIDNYQTHVVPII
ADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLCKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQSPDDLAAQYNAFLETSEVSSVDDLKD
GDSVLKLDGKLVKPVRLPNGLYKFKENTGFDRVVLDCITSLQNGADLLWIETEKPHVQQI
GEMVSAIRKEVPDAKLVYNNSPSFNWTLNFRQQVFDAWSEQGKDVADYNRDELMSARYDA
SELAQEADEKVRTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVKG
VQRKELREGLACVKHQAMAGSNLGDDHKEYFSGEQALKASGKDNTMNQFDVAV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatacaaatgacattcaagctgcccaaaccttaacaggcgaaaatagccaa
acgtggaatgcaatcaaccctgaatacgttgcacgaatgaaagcacaaaaccgcttcaag
acaggcttagacattgcgaaatacactgcgggtatcatgcgtaaagatatggctgactat
gacaatgattcaagctcatatacgcagtctctaggttgctggcacgggttcatcggccaa
caaaaaatgctagccattaagaagcatcacggtaccactgataagcgttatttgtattta
tcaggttggatggtagcggcgctgcgttctgagtttggcccactaccagaccaatctatg
cacgaaaaaacgtcagtacccgctttaatagaagaactttataccttcttgcgccaagct
gacgcgaaagagttaggcgaattattcacagcccttgataaagcaaaagaagcaggcgaa
agcacgcaagagattcaagacaaaattgataactaccaaactcacgtagtacctattatt
gctgatattgatgccggttttggtaacgaagaagcaacttacttacttgctaaaaagatg
atcgaagccggtgcatgttgtattcaaatcgaaaaccaagtgtctgatgcgaaacaatgt
ggccaccaagacggcaaggtaaccgtacctcatgaagatttcttgtgtaaaatcaatgca
gtacgttacgctttccttgagctaggtgtagatgatggtgtgattgttgcccgtactgat
tctctaggtgcaggcctgacgcaaaaaatccctgtgtctcaatcacctgacgacttagcg
gctcaatacaatgcctttttagaaacctcagaagtgtcttctgttgatgatctaaaagac
ggtgactctgtgttgaaactagatggcaaacttgttaagccagttcgtttaccgaatggg
ttgtacaagttcaaagaaaacactggtttcgaccgtgtggtacttgactgtatcacctca
ctacaaaatggtgctgacttactgtggattgaaacagaaaaacctcacgttcagcaaatt
ggtgaaatggtaagtgccattcgtaaagaagtaccagacgcgaagctagtttataacaat
tcgccttctttcaactggacgcttaacttccgtcagcaagtatttgacgcatggtctgag
caaggtaaagatgtagctgactacaaccgtgatgaattgatgtctgcacgttacgacgcc
tctgaactggctcaagaagcagacgaaaaagtacgcacattccaagctgatgcagcacgt
gaagcaggtatcttccatcacttgatcacactaccaacttaccatacggcagcactttca
actgataacctagcgaaaggttacttcggtgaggaaggtatgttggcatacgttaaaggt
gttcaacgtaaagagctacgtgaagggttagcttgcgtgaaacaccaagcaatggccggc
tctaacttaggtgatgatcacaaagaatatttctctggtgagcaagcgcttaaggcatca
ggtaaagacaacactatgaaccagttcgacgttgccgtataa

DBGET integrated database retrieval system