KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3191Help
Entry
Glaag_3191        CDS       T01483                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Glaag_3191
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Glaag_3191
   00630 Glyoxylate and dicarboxylate metabolism
    Glaag_3191
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Glaag_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3718221..3720392
Genome map
AA seq 723 aa AA seqDB search
MQAYIQREQLQVAKELATFIEDHALPGSEVSPADFWASFSNILAQLTPVNDALLAKRDSL
QTKIDEYCQTHSPLEPSAYKTFLQDIGYLETPPADFSITTEQVDVEVAAMAGPQLVVPIN
NARFALNAANARWGSLYDAVYGTDVIPEDNGATRTKEYNPTRGQKVIDYARKWLDVIAPL
TNGSHTSSQGYDITSGQLVITLNDERTATLTNPSQFVGFSGDKNSPSAILLVHNGLHIEL
QFDRSHQIGQRDPSGMKDILVESALTTIMDCEDSVAAVDAEDKTLVYQNWLGLIKGTLEV
NLNKPGSSSIRRLNADRHYTSVDGQPKTLNGRSMMFVRNVGHLMTNDAILFQDKPIYEGI
MDAMITSLIAKHDLLGNGAYRNSKAGSIYIVKPKMHGSEEVAFADTLFSRVEDALSLPKN
TLKMGIMDEERRTSVNLKACIHAAKARAVFINTGFLDRTGDEIHTSMHLGPFALKAEIKQ
QPWLTAYELANVKIGVDAGMSGKAQIGKGMWPIPDNMADMMQSKTNHPQSGANTAWVPSP
TAATLHALHYHQIDVFKLRQPIVTNDFDGLDDILTVPLLENRSALNEQDIQRELDNNVQG
ILGYVVRWVHQGIGCSKVPDINDVGLMEDRATLRISSQHIANWLLHGLINETQINDSMLR
MAKLVDEQNRSDKEYIPMMPDPIESIAFQAAQELILQGTAQPNGYTEPVLHAKRREMKEK
LAN
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcatacattcaacgtgaacaattacaggtagcaaaagaacttgctaccttcatc
gaagatcacgctctaccaggcagtgaagtgtccccagcagatttttgggctagttttagt
aacattctcgcccagctcacccctgtgaatgacgcattgttggctaaacgagattcactg
caaacaaaaatcgatgagtattgccagactcattcacctcttgagcccagcgcttataaa
acctttctacaagacataggctatttagaaacgccaccagcggacttttcgattaccact
gagcaggttgatgtcgaagtggcggctatggccggtccacagctcgttgtgcctattaat
aacgcgcgctttgcacttaatgctgcgaatgctcggtgggggagcttatatgacgcggtc
tacggtacagatgttattcctgaagataacggagcgacacgtaccaaggaatacaatccg
acacgaggccaaaaggtaatagactacgcaagaaagtggctagatgttatcgccccactg
acaaacggctcacatacaagcagccaaggttacgatattacatcaggtcagttagtgatc
acccttaatgatgaacgcactgctaccctgacaaaccctagtcagttcgttggttttagt
ggcgataaaaacagtcctagcgcaatcttattagtccacaacggtttacatatagaactt
cagtttgatcgctcacatcagattggccaacgtgatccctcaggcatgaaagatattctt
gtggaatcggcgctgaccaccatcatggattgcgaagattcagttgccgccgtagatgcc
gaagataaaactctggtttatcaaaactggttagggttaataaaaggcacccttgaggtg
aaccttaataagccaggtagctcatccataagacgcttaaacgcagatcgccactacaca
tcagttgacggacaacctaaaacattaaatggccgcagcatgatgtttgtgcgtaatgtg
ggtcatttaatgacgaacgacgcgatattgtttcaagacaaacccatctatgaagggatc
atggatgcaatgattaccagcctaatcgctaagcacgatttactcggaaatggcgcgtac
cgaaacagtaaggcaggcagcatctacatcgttaagcctaaaatgcacggctcggaagaa
gtcgccttcgctgacaccctgtttagccgagttgaggatgcactttcattaccgaaaaat
accttgaagatgggtattatggatgaagagcgtcgcactagtgttaatttaaaagcctgt
attcatgcggctaaagctcgcgcagtgtttattaataccggctttttggatagaactggt
gatgaaattcatacttccatgcatttagggccatttgcgttaaaagctgaaatcaagcaa
cagccttggttaactgcctatgagttagccaacgtgaaaattggtgtagacgccggtatg
tctggcaaggcacaaataggtaaaggtatgtggcctataccagataatatggcggatatg
atgcaaagtaagactaaccatccgcaatctggtgcaaataccgcatgggttccctcgcct
actgccgcaacgctgcatgctttacattatcatcaaatagacgtattcaaattacgccaa
cctattgtaacaaatgactttgatgggctagacgacattctcacagtaccattgttagaa
aaccgttcagctcttaatgagcaagacatacaacgggagttagacaacaatgtgcaggga
attctaggttatgtggtgcgctgggtacaccaaggaattgggtgctcgaaggtacccgac
attaatgatgttgggctaatggaagacagagcgactctaaggatttctagtcagcatatt
gctaactggctgttgcacggtttgattaacgaaacacaaatcaatgactctatgttgcgc
atggctaaactagtagatgaacaaaatcgttcagataaggaatacatccctatgatgcct
gatcctatcgaatcgattgcctttcaagcggctcaagagcttatattacaaggaacggct
caaccaaatggttacaccgaaccggttttgcacgctaagcgcagagaaatgaaagagaaa
ctcgctaactaa

DBGET integrated database retrieval system