KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3419Help
Entry
Glaag_3419        CDS       T01483                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gag00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3999315..4000295)
Genome map
AA seq 326 aa AA seqDB search
MTGKYLISAESELEQTYQDKIKPLMRSLVKGRFEGHSGINISYAYLSHPEEKGAVAISTG
RIESWVKYQEVMFDLYQNGYSVFIHDHRGQGLSDRMTQNPQMGFVHDFADYVADFKVFYQ
QVIEPNTQHKPQLVCHSMGCAIGALYVLAHPQDFAQLIVCAPMFGIRPALPNWLANILIG
TNLLISRGLGHDASYFPGQRNYRETEFALNELTHSNIRYRLFRDEYNLQPEVQLGGVTGH
WLRAALRAMDTIEAQASQIRLPVWAIQAGDDTVVDNKRQSRVLAEIPHCEVQHIAGARHE
MLLEEDQYRVPCLEAILAFLQLAPAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaatacctgataagcgcagaaagtgagcttgagcaaacctaccaagacaag
ataaagcccttaatgcgttcacttgtaaaaggtcgctttgaaggtcactcaggtatcaat
attagctatgcctatttatctcatcctgaggagaaaggagcggttgctatatcaaccggc
cgaatagagtcttgggtgaagtaccaagaagtgatgtttgatctgtaccaaaatggttat
tcggtgtttatacatgatcaccgaggccaaggtttatcagaccgtatgacgcaaaacccg
caaatgggctttgtgcatgactttgctgattatgttgctgactttaaagttttttatcaa
caagtcatcgagccgaacacgcagcataaacctcaattagtatgccactcgatgggatgt
gccatcggagccttatatgtgttagcacaccctcaagacttcgctcaactgattgtgtgt
gcacctatgtttggtattcgtcctgcgttaccaaattggttggcgaatattttgattggt
accaatttattgattagccgcggtttagggcatgacgcgagttactttccgggacaaaga
aattatcgtgagactgaatttgcgctcaacgagttaacccatagcaatatacgttaccga
ttatttcgcgatgaatataacctgcagcctgaagttcagctaggcggtgtgacaggccat
tggctgcgtgctgcgttaagagcgatggacaccattgaagcccaagcgagccaaattagg
cttcctgtttgggccatccaagcaggagatgacacagtggtggataacaaaaggcagagt
cgagttttagccgaaatacctcactgtgaggtgcagcacatcgcaggtgccagacacgaa
atgttgctagaagaggatcaatatcgggtgccctgtctagaggctattttagctttcttg
caacttgcacctgccagataa

DBGET integrated database retrieval system