KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3419Help
Entry
Glaag_3419        CDS       T01483                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Glaag_3419
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Glaag_3419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3999315..4000295)
Genome map
AA seq 326 aa AA seqDB search
MTGKYLISAESELEQTYQDKIKPLMRSLVKGRFEGHSGINISYAYLSHPEEKGAVAISTG
RIESWVKYQEVMFDLYQNGYSVFIHDHRGQGLSDRMTQNPQMGFVHDFADYVADFKVFYQ
QVIEPNTQHKPQLVCHSMGCAIGALYVLAHPQDFAQLIVCAPMFGIRPALPNWLANILIG
TNLLISRGLGHDASYFPGQRNYRETEFALNELTHSNIRYRLFRDEYNLQPEVQLGGVTGH
WLRAALRAMDTIEAQASQIRLPVWAIQAGDDTVVDNKRQSRVLAEIPHCEVQHIAGARHE
MLLEEDQYRVPCLEAILAFLQLAPAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaaatacctgataagcgcagaaagtgagcttgagcaaacctaccaagacaag
ataaagcccttaatgcgttcacttgtaaaaggtcgctttgaaggtcactcaggtatcaat
attagctatgcctatttatctcatcctgaggagaaaggagcggttgctatatcaaccggc
cgaatagagtcttgggtgaagtaccaagaagtgatgtttgatctgtaccaaaatggttat
tcggtgtttatacatgatcaccgaggccaaggtttatcagaccgtatgacgcaaaacccg
caaatgggctttgtgcatgactttgctgattatgttgctgactttaaagttttttatcaa
caagtcatcgagccgaacacgcagcataaacctcaattagtatgccactcgatgggatgt
gccatcggagccttatatgtgttagcacaccctcaagacttcgctcaactgattgtgtgt
gcacctatgtttggtattcgtcctgcgttaccaaattggttggcgaatattttgattggt
accaatttattgattagccgcggtttagggcatgacgcgagttactttccgggacaaaga
aattatcgtgagactgaatttgcgctcaacgagttaacccatagcaatatacgttaccga
ttatttcgcgatgaatataacctgcagcctgaagttcagctaggcggtgtgacaggccat
tggctgcgtgctgcgttaagagcgatggacaccattgaagcccaagcgagccaaattagg
cttcctgtttgggccatccaagcaggagatgacacagtggtggataacaaaaggcagagt
cgagttttagccgaaatacctcactgtgaggtgcagcacatcgcaggtgccagacacgaa
atgttgctagaagaggatcaatatcgggtgccctgtctagaggctattttagctttcttg
caacttgcacctgccagataa

DBGET integrated database retrieval system