KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3507Help
Entry
Glaag_3507        CDS       T01483                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gag00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gag00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gag00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4112301..4115540
Genome map
AA seq 1079 aa AA seqDB search
MLYARYATFFIITQVCLWLPATGSAKPIEVKNDWENPDVIHINRLPARATSYSFDSTEQA
LTRDRSQSTMKSLNGQWKFHFAEKSQNRPKDFYRTDFDSQSWSSITVPANWELEGYGTPI
YTNSVYPMFEDENDIVLPLITRDNPVGSYLTDFSVPKDWQNEQIILHFGGVTSAYYVWIN
GQKVGYAQGSRLPSEFDITDYLVPGENTLAVQVFRWSDGSYLEDQDHWRLSGIHREVLLM
AQPKVALNDFFVQTHLSDNYQQGVIEINPKLSNPERQNLAGWKVSATLYNAMNQEVENTQ
MQVDATRLTRVAYPQRDNFAFGLMKTKVNKPALWTSETPNLYTLVLSLHNQQGKLVETRS
TRVGFRDVNISPQGELLINGQSVELIGVNRHDHDAKKGKALNREDLRQDVIKLKQFNFNA
VRTSHYPNDPYFYELADEYGLYVMDEANIESHGVGGLLANLPQWNDSMSQRALRMLERDK
NHPSIISWSMGNESGTGPNFAAIAGWLKDKDPTRFVHYEGAQGDPTHPQYVGLSERYPTA
EEKSQYFTPLANPTDPKFVDVISRMYPTLEDLKGLADSPYIDRPILMCEYAHAMGNSLGN
LAEYWEMVRARPNLIGGFIWDWIDQGLETQNAQGETYLAYGGDFGDTPNASNFCLNGVMD
SYRQPNPHAWEAKYVFQPAEFTLLDPAKGEISVLNRFFFNNLADYDISWSLSEDGTRISQ
GVIQSGDVAPGAHKNLMLPYQKPQIKPGAHYWLNVSLLLPEDTLWAAKGHELAKAQFSLP
FSRPAEKVAISKSTLQVDDTETKIVISTDNKRIAFDKTTGYLNSLVADELQVLHEPLKHN
FWRPQTDNDRLGWKTLENKKVWFDATQHLALSSFEYSQTDTGVTVKTRHTNGSSIKVATQ
YHINATANVTVNVTLDADADLPSLLRVGMSTAVSGELERMAYYGKGPHENYIDRNQSAET
DVYQGLVSDFIHSYARPQENGNRTGVKWLTLSDYAQHSFSVKGLQDLSMSVWPWSAENLQ
EANHPYELVERGIYTVNIDLAQAGVGGIDSWSDKAAPIEKYQLPSGQYQYQFTLTVGQQ
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgctttacgcccgttatgccactttcttcatcattacccaagtatgtttatggctgccc
gctacggggagtgcaaaaccaattgaggtcaaaaacgattgggaaaacccagacgttata
cacatcaatcggttacctgctagagccacctcctattcttttgactccaccgagcaggca
ttaacccgagatcgcagtcaatccaccatgaaaagcttaaatggccagtggaagttccat
tttgcagagaaaagtcaaaatcgacctaaggatttctatcgcacagattttgacagccaa
tcttggtcttccattacggtgccggcaaactgggaactagagggctacggcacaccgatt
tataccaactcggtctatccgatgtttgaagatgaaaacgacatcgtattgccattgatc
acccgtgataatcctgtaggttcctatttaacagactttagcgtaccgaaagactggcaa
aatgagcagattattttgcattttggcggggtcacctcagcctattacgtgtggataaat
ggccaaaaagtcgggtatgcacaaggcagccgcctgccatcggaattcgatattaccgat
tacctagtacccggtgaaaatacgttagcagtgcaagtgtttcgctggagtgatggcagt
tatttagaagaccaagaccactggcgattaagcggtattcacagagaagtcttactgatg
gcccaacctaaggtcgctttaaatgattttttcgtgcaaacccacttgagtgacaactac
caacaaggtgtgattgaaatcaatcccaagctgtctaaccctgagcgacaaaatttagca
ggttggaaagtcagtgcaaccctatacaacgcgatgaaccaagaggtagagaatacgcaa
atgcaagttgatgccactaggttaacgcgtgtggcttatccccagcgagataactttgca
tttggcctcatgaaaaccaaagtaaacaaacctgccctatggacatcagaaacccctaat
ctctacacgctagtattaagtttacacaaccaacaaggaaagctggttgaaacccgaagc
actcgggtgggatttcgcgacgttaacattagcccgcaaggcgagctacttattaacggc
caaagcgttgaacttattggtgtgaatcgtcatgaccatgacgccaaaaaaggcaaggca
ctcaaccgagaagacttgcgccaagacgttattaagctaaagcagtttaactttaacgcg
gtgcgcacctctcactaccctaacgatccgtatttttatgaactcgctgatgagtacggt
ttatatgtcatggatgaagccaatatcgagtctcatggcgttggtggcctacttgccaac
ttacctcagtggaatgactcaatgagtcagcgtgctttgcgaatgctggaaagagataaa
aaccatccgtctattatttcatggtccatggggaatgagtccggaacaggccctaacttt
gccgcaatagcaggttggctgaaagataaagatcccactcgttttgtgcattacgaaggc
gcacaaggtgatcccacccatccacaatacgtcggtttgagtgagcgctacccgaccgca
gaagaaaaaagtcagtattttacgccccttgctaatccaactgatccaaaatttgttgat
gttattagtcgaatgtaccccacccttgaggatctaaaaggcttagcagacagtccttat
atcgaccgccctattttaatgtgtgagtacgcccacgccatgggcaactcgctgggaaat
ctcgctgaatactgggaaatggttcgagcacgacccaacctgattggcggcttcatctgg
gactggattgaccaaggcttagaaactcaaaacgcacaaggcgaaacctaccttgcctac
ggtggcgactttggtgacaccccaaatgcatctaacttttgcttgaatggcgtcatggac
tcttatcgccaacctaatccccatgcttgggaagccaaatatgttttccaaccagctgaa
tttactttacttgacccagccaagggtgaaataagcgtactcaatcgcttcttttttaat
aacttggctgactacgatataagctggtcgctttctgaggatggtacgcgtatttcacaa
ggggtaattcaatcaggcgatgtggcgccaggggcacataaaaacctcatgctcccttat
cagaaaccgcaaattaaaccaggcgcacattattggttaaacgttagtttgttgcttcca
gaagatacattatgggcagcgaaaggccacgaactcgctaaagcgcaatttagcttacct
ttctctcgcccggctgaaaaagtagccatcagtaaaagtaccttgcaagtggatgacacc
gaaacaaaaatcgtcatatccacagacaacaagcgtattgcttttgataaaacaacgggt
tatctaaacagcttggttgctgatgagttgcaggtgttacacgaacctcttaagcataac
ttttggcggccacaaaccgataacgatcgcctcggctggaaaaccctagaaaacaaaaaa
gtatggtttgacgctacgcagcatttagcccttagcagctttgaatacagtcaaactgat
actggggtaacagtgaaaacccgacatacaaacgggtcttcaatcaaagtcgccacccaa
taccacattaatgctacagctaatgtaactgttaacgttacgctagatgcagacgcggat
ttacctagtttgttgcgagtaggtatgtctacagcggtaagcggtgagctagagcgcatg
gcctactatggtaaaggccctcatgagaattacatcgaccgtaatcaaagtgcagaaaca
gacgtataccaagggttagtatcagactttatacacagctacgcgcggccccaagaaaac
ggaaatcgcaccggagtgaagtggttaacgttaagtgattacgcccagcactcgtttagc
gtaaaaggcctacaagatcttagtatgtcagtttggccttggtcagccgagaacttacaa
gaagctaatcatccatacgaattggtcgagcgcggtatctacaccgtcaacattgacctt
gctcaagccggtgttggcggtatcgactcgtggagcgacaaagcagccccgattgaaaag
taccaactgccatctggtcagtatcaataccaattcaccctaacagtaggacagcagtag

DBGET integrated database retrieval system