KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3560Help
Entry
Glaag_3560        CDS       T01483                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00260  Glycine, serine and threonine metabolism
gag00750  Vitamin B6 metabolism
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01230  Biosynthesis of amino acids
Module
gag_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Glaag_3560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Glaag_3560
Enzymes [BR:gag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Glaag_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEE24492
UniProt: F4ATF9
Position
complement(4193626..4194909)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDPSDKVSFAEAVKKGLGKNQGLYFPTSLPTFDDIDAILDMPFVERSVEILSQL
IGDEIPRDRLQGIVERAFAFEAPLAKVADNVYSLELFHGPTLAFKDFGGRFMAQCLTEIA
AGEKITILTATSGDTGAAVAHAFHGLDNINVVILFPKGKISPLQEKLFTTLGDNIHTVSI
EDDFDACQQMVKSAFDDVDVREGLHLNSANSINISRLVAQVCYYFEAISQLSKEQRENAV
ISVPSGNFGNLTAGMIAKTMGLPVKHFVAATNLNDTVPRYLKTGEWDPKDTVATMSNAMD
VSQPNNWPRIEAIIEQGYLPREVLSGDTVDEDYTQVAMRQLAQIGYVSEPHAAVAYKALV
RHMEEGDTGIFLGTAHPAKFRETVENVLGQPISLPQPLVDCSTKESLAVNLPSDYETLKK
HLFSLLG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaactagttaatttaaaagacccctcagacaaagtcagctttgcagaagcggttaaa
aaagggttaggcaaaaaccaagggttatatttcccaactagtttgccaacatttgatgac
atcgacgccattcttgatatgccgttcgttgagcgctcggtggaaattctgagtcaatta
attggtgacgagatcccgcgggaccgtttgcaaggtatcgttgagcgtgccttcgccttt
gaagcgcctttggcaaaagtggctgacaacgtttacagccttgagttgttccacgggcca
accctcgcgtttaaggactttggcggccgttttatggcccagtgtttaactgaaattgcc
gcgggcgagaaaatcactattctaaccgccacttctggcgatacgggtgctgcggttgct
cacgcgttccacgggttagataacatcaatgtggttatcttgttcccgaaaggcaaaatt
agcccgttacaagaaaaactgtttactaccttaggtgacaacattcacacggtatcgatt
gaagatgatttcgatgcatgtcaacaaatggtaaaaagcgcctttgatgatgtagacgtg
cgtgaagggttacaccttaactctgcgaactctatcaacatcagccgtttggttgctcag
gtgtgttactactttgaagcgatttcacagctaagcaaagagcagcgtgaaaacgcagtt
atctctgtgcctagtggtaattttggtaatttaaccgcaggtatgattgccaaaaccatg
ggcttgccggttaagcacttcgttgcggcaactaacttaaacgataccgtgccacgttat
ttaaaaacgggcgaatgggatccaaaagacacggttgcgaccatgtctaacgcaatggat
gtaagccaaccaaacaattggccacgtatcgaagcaatcattgaacagggttacttaccc
cgtgaagtgctttcaggtgataccgttgatgaagattacactcaggtggctatgcgccaa
cttgcgcaaatcggctacgttagtgagccccatgccgcagttgcatacaaagcgttagtt
cgccatatggaagaaggcgatactggtatattcctaggtacagcgcacccagctaagttc
cgtgaaacggtagagaacgtactcggccagccgattagtttgcctcagcctttggttgac
tgttctaccaaagaaagcctagcggtaaacttaccaagcgattatgaaacgcttaaaaag
cacttgtttagcttattaggctaa

DBGET integrated database retrieval system