KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3678Help
Entry
Glaag_3678        CDS       T01483                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gag00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gag00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:gag00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4342738..4344894
Genome map
AA seq 718 aa AA seqDB search
MTQHAAQFIALHGQKSSLILDVGYDTPQIIYWRTKLSEQSTGEMMRALRLRQEAPVSPIV
ELDLCITPTSGQGFTGLPGLSLHGDTDQWAANPKLKSISQDNEHSATLTSVDAARGVEVV
VTIKLDAETDVLTFDTVLNNITEQSITLDWCAAATVPTPADFDQIIGFEGHWAGEFQQHS
LDQFFGSYVRENRRGKTSHDSYPALLLHPKTTNQAQGEAYGFHLGWSGNHKIVAEKMADG
RSYVQMGELLFPGEIVLEKDQSYQTPTLFASYTDQGLSVLSQQFHQYVRTHIIRQSVHDK
PRPVHYNTWEGIYFNHDVETLKDLAERAAEMGAERFVLDDGWFIGRNDDTAGLGDWYVDK
AFYPQGLTPVIDHVKAQGLEFGLWFEPEMVNPDSELYRQHPEWVLGNEVSKQIDCRNQLV
LDLSRPEVFDYLFERLDSLLTEYDISYVKWDMNRDLNHQGNHSGKPGGHNQIHAVYRLLD
KIRETHPQVEVESCASGGGRADYGVLARTDRVWTSDSNDALERLKIQNGFSYFLPSELMG
SHVGPRECHITHRTVSMEMRASVTLFGHMGMEMDLRELTDAEKVELKAMTDLYKQHRALV
HSGDLFRLELPAYMNGLGIVAKDKSQALFSYSLIACSSATLPDQYKFAGLEKNSQYKLDI
IWPIKNTDKWPKSGLFGFANHLGAVDGHVFSGELLMQLGMQMPLLTPQSSLLFHLTKV
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacatgccgcacaattcattgcacttcatgggcaaaaaagcagtctaatttta
gacgtcgggtacgataccccacagatcatttattggcgcactaagctatcagaacaatcg
actggtgagatgatgcgtgcattgcgcctgcgtcaagaagcgccggtgtcacctattgtt
gaacttgatctgtgcattacgccaacatcgggccaagggttcacaggcttacctgggctt
agtttgcacggtgacacagatcagtgggctgcgaaccctaaattaaaatcaatctcccaa
gataacgagcacagcgcaacattaaccagtgttgatgctgcccgtggtgtcgaagtcgta
gtgacgattaagctagacgcagaaacggatgttctgacctttgatacggtgttaaacaac
atcacagaacaatcaattacgctagactggtgcgcagcggctaccgttccaacccctgcc
gacttcgatcaaattattggcttcgaaggccattgggctggagagtttcagcaacatagc
ttggatcaattttttggttcatacgtgcgcgaaaatcgtcgaggtaaaacctcacatgac
agttaccccgcgctattacttcacccaaaaaccaccaatcaagctcagggtgaagcctac
ggatttcatttaggctggagcggtaatcacaagatcgtcgctgagaaaatggctgacggg
cgctcttatgtacaaatgggcgagttgcttttccctggtgaaattgtgctagaaaaagat
cagagctaccaaacaccgaccttgttcgctagctacactgaccaaggcttgtctgtgctg
tctcagcagtttcatcagtacgtacgaacccacattattcgtcaaagcgtgcacgataag
cctcgcccagtgcactacaacacctgggaaggcatatacttcaaccacgacgttgaaacg
ctgaaagacctagccgaaagagctgctgaaatgggcgccgaacgctttgttttagacgac
ggttggtttattggccgcaacgatgacaccgcaggtttaggtgactggtatgtcgacaaa
gccttttatccacagggcctaaccccagtcattgatcatgtaaaagcccaaggcctagag
tttggtttgtggtttgagcctgaaatggttaaccctgacagcgagctttatcgtcagcac
cctgagtgggtattaggaaatgaagtcagcaaacagatagattgccgtaatcaattagtc
ctcgatttgtctcgtccagaggtgttcgactacctgtttgaacgcttagactcgctactt
acagagtatgatattagctacgtaaaatgggacatgaaccgcgatttgaaccatcaaggc
aaccatagcggtaagccaggtggtcataatcaaatacatgctgtatatcgcttactggat
aaaattcgtgaaacacacccgcaagtggaagttgaaagctgtgcatctggcggcggtcgt
gctgactatggcgtactggcgcgaactgaccgcgtatggacttcagattctaacgatgca
cttgagcgtctcaaaattcaaaacggtttctcgtatttcttgccttcagagctgatgggc
tcacatgttggcccaagagagtgtcacattacccatcgtactgtgtccatggagatgcgc
gcttcagtgacgttatttggtcacatgggcatggagatggatttacgtgagctaaccgac
gccgaaaaagttgagctcaaagccatgaccgacttatacaagcaacatcgcgctctggta
cacagtggtgatttgttccgcttagaacttcctgcttatatgaatgggctgggtattgtt
gctaaagataagtctcaggcgttgttttcatatagcctaattgcttgtagttcagcaacc
ttaccggaccaatacaaatttgcaggcttagagaaaaacagccagtacaagcttgatatt
atttggccgataaagaacactgacaaatggcctaaatccggtttatttggtttcgctaat
catctaggggctgttgacggccacgtatttagcggtgaattactgatgcaattgggcatg
caaatgccgctattgactccgcaaagcagcttgctatttcacctaacgaaggtctag

DBGET integrated database retrieval system