KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3704Help
Entry
Glaag_3704        CDS       T01483                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
Enzymes [BR:gag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Glaag_3704
Secretion system [BR:gag02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Glaag_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4367492..4368277)
Genome map
AA seq 261 aa AA seqDB search
MKLFFPVRVLSLSVQIGIYMKYRALLLAAFTFLSVSSGMSMAADNKQNLDSVKQKIQMSL
GMQVTSIGDAPVPGLLQVQTDKGLFYTSDDGKYFLQARIFNLDEGMRNETETTLTKMRID
GIEHFKDSVIEYKADKEKYVVNVFTDITCGYCRKLHNQMEEYNDLGITVRYLAFPRAGIN
SKPYQDMVSVWCAANPQKALDEAKGGENVAKASCSNQVAEQYNFGQSVGVNGTPNIVLPD
GSVVPGYQPPEKLLQAIQHAS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttttcccagttagggtcttatctttatccgttcaaattggaatttatatg
aaatatcgtgcgttattactggctgcgttcaccttcttatcagttagctctggcatgagc
atggcagctgacaacaagcaaaatcttgatagtgttaaacaaaaaattcaaatgtcgtta
gggatgcaagtaacgtcaattggtgatgcgcctgtccctgggctattgcaagtacaaacc
gacaaggggcttttttacaccagcgatgacggcaagtactttttgcaggctcgtatcttc
aacttagatgaaggtatgcgcaatgaaactgaaacaacattaaccaaaatgcgcattgat
ggcattgaacatttcaaagactcagttattgaatacaaagctgacaaggaaaaatatgtg
gtgaatgtgtttaccgatattacctgtgggtattgccgtaaactgcataaccaaatggaa
gagtacaatgatttggggattacagtacgctacttagcgttccctcgcgcagggatcaac
agcaagccctatcaagacatggtgtcagtttggtgcgctgccaacccgcaaaaagcctta
gatgaagccaaaggcggtgaaaacgtagccaaagcaagttgttcaaatcaagtcgcagag
caatataattttggtcagagtgtgggcgtaaacggtacgccaaatattgtcttacctgat
ggtagcgttgtgcctggttatcaacctccagaaaaattactgcaagcaatacaacacgca
tcataa

DBGET integrated database retrieval system