KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3896Help
Entry
Glaag_3896        CDS       T01483                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Glaag_3896
   00630 Glyoxylate and dicarboxylate metabolism
    Glaag_3896
   00640 Propanoate metabolism
    Glaag_3896
   00650 Butanoate metabolism
    Glaag_3896
  Lipid metabolism
   00071 Fatty acid degradation
    Glaag_3896
   00072 Synthesis and degradation of ketone bodies
    Glaag_3896
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Glaag_3896
   00310 Lysine degradation
    Glaag_3896
   00380 Tryptophan metabolism
    Glaag_3896
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Glaag_3896
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Glaag_3896
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Glaag_3896
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Glaag_3896
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4599631..4600836
Genome map
AA seq 401 aa AA seqDB search
MKDAYIYDGLRSPFGRFKGGLSSVRPDDLLALVIKQLVERNQFQASEYEDVIAGNTNQAG
EDCRNVARFAGLLAGLPIGCGGITVNRLCGSGLASVMDASRCVQSGDGDLFIACGVESMS
RAPLVISKAQSAFDRNQTVADSTMGARFSNPLIEANFGADSMPETADNIAAALKITREQC
DAFAAASQSKYEAARASGFFKDEMLNVEVPQPRKKPPIVIDSDEHPRASTDIDALRGLRS
LYADGVVTAGNASGINDGASALIIGSKKAGEAHGIQPRARIIASAIAGVEPKLMGLGPVP
ATKKALARAGLELKDMNVIEVNEAFASQVLGCLKELNIAANDSRVNANGGAIAVGHPLGA
SGGRLVLTALRQLEATNGRYGLITMCIGIGQGIALIIEREG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgcatacatatacgacggattaaggtcgccttttgggcgtttcaaaggtgga
ttgtctagcgtcaggccagacgatttactggcacttgtgatcaaacaacttgttgagcgt
aatcagtttcaggcatctgaatatgaagatgtcattgctggcaataccaatcaggcaggg
gaagattgtcgaaatgtcgctagatttgcgggactcctcgctggattgcctatcggttgt
ggtggaattacagtaaatcgattgtgtggttcgggtttagcaagtgttatggacgccagc
cgatgtgtgcagtctggtgatggcgatttgtttatagcttgcggcgtagaaagcatgagc
agggcgccattggttatttccaaagcacaaagcgcatttgatagaaatcagacagttgcc
gattcgactatgggagcaagattctctaatcctttaattgaagctaactttggcgcagac
agtatgccggaaaccgctgacaatattgcggctgctctgaaaattactcgcgaacaatgc
gacgcatttgcagccgcttctcagtcgaagtatgaagctgctagggcatctggatttttc
aaagacgagatgcttaatgtagaagtgccgcaacctagaaagaagccacctattgtcatt
gacagtgatgaacatcctcgtgctagtaccgatatcgacgctttgaggggtttaagatct
ctttatgccgacggtgttgttaccgcagggaacgcctcgggaattaatgatggcgcttcg
gctttaataataggctctaaaaaagctggagaagctcatggaattcaacctcgggcacgt
attattgctagcgccattgccggtgtcgaacctaaattaatggggttaggtccagtacct
gccactaaaaaagccttggctagggctggtttggaattaaaggatatgaatgttatcgaa
gtaaatgaggcgtttgcgtcacaagttctaggttgcctaaaagaattaaatatcgccgcg
aacgattcaagggttaacgctaacggcggggctattgctgtgggtcatccgttaggtgcc
agtggcggaaggcttgtgttgacagcgttacgccagctagaggcgacaaatggtcgttat
ggactaatcaccatgtgtattgggattggtcaaggtattgccttaattattgaaagagag
ggataa

DBGET integrated database retrieval system