KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3923Help
Entry
Glaag_3923        CDS       T01483                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4635643..4636131)
Genome map
AA seq 162 aa AA seqDB search
MNQVYVGLGSNLAQPEQQIKDALLAIASLADTCVTATSSLYVSRPMGPQDQPSYVNAVVG
VQTEMQPVEFLHCLQKIELEHGRERKAERWGPRTLDLDILLFSNQVIDSVELTVPHYGMK
EREFVLYPLHEIAPELQLPNGTKVSEMLNNCPLNGLEKLPYK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtttatgttgggttaggcagtaacttagcccagcctgaacaacaaataaaa
gatgcattactggccattgcgtcgttggctgatacttgcgtaactgccacgtcgagcttg
tatgtgagtcggccaatggggccgcaagaccaacctagctatgttaacgcagtggttggc
gtgcaaactgaaatgcaacctgttgaatttcttcattgcttacaaaaaattgaacttgaa
catggtcgtgagcgtaaagctgagcgctgggggcctcgtaccctagacttggatattctg
cttttttcgaatcaagttattgattctgttgaacttacggttccgcattacggtatgaaa
gaacgagagtttgtcttgtatcctctacatgaaattgcccccgaattacaacttccaaac
ggcacgaaagtgagcgaaatgctcaataattgccctctcaatgggttggaaaaattaccc
tataaatga

DBGET integrated database retrieval system