KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_4041Help
Entry
Glaag_4041        CDS       T01483                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gag00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gag00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4783283..4785184
Genome map
AA seq 633 aa AA seqDB search
MGVRPVRILLVSLLVLTFVSCANKPSVDPRIEALVAQKLMLDIRYFCRENDINPATQRCT
TPVTTLPDELKDMVADTGIGGIILFANNLQDTEQMIRLNRDLQAASAAGGHSPLLISIDQ
EGGRVVRIPQNISTAFSGNMAIGATYAEHGTHFATLSGDVIAKELAVLGFNVNFAPSVDV
NVNPENPVINVRSFGEDPHVVSQLGFAQMQAMQNNKVIAALKHFPGHGDTSTDSHSGLPL
VEHDLAQIKAVDLAPFQYAIDHGDPGMIMTAHIQYPALDNSMFTATNGTKTVLPATMSRA
ILTDLLRDKMGFNGVIITDALDMAAIAHFYEPTEAVLQTFKAGTDVALMPLAIRTAQDIP
KLKKMIKDLAYSVQTGELSLAEVEQSVARINTLKQRYVPTEKEQLPLSQALVKARKTLAS
PAHLKAEQELANSAIVAIKNQQAWPIKPATKIIQLVMPDNSKCMAMTTALDDALKATPST
TDVAIRCASLVSDTTQHIIAQQRTAQLVIFSDITPQQSLVEMGGMDDITDWRLRPKKEAL
DAKLVSLMKEVKPHQISLLISMRTPYAVVDYADYLDGILASFAYNTQVTEQVDASGQATL
YYDGPIYRALANILVGNQRATGALPVSIDKVND
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttaggccagtgcgtattttgttagtcagtttattggtcttaacctttgtttcc
tgcgcaaacaaaccatctgttgatccgcgaattgaagccttagtagcccaaaagctaatg
ctcgatatacgctatttttgtcgtgaaaatgacatcaatcctgcgacgcagcgctgcacc
actcctgtgaccacattacctgacgagcttaaagacatggttgctgatacgggtatcggc
ggcattattttgtttgccaataatttgcaagacactgaacaaatgatccgtttaaaccgt
gacttgcaagctgcatcggcagcaggcggccactctcctttacttatatccatagaccaa
gaaggcgggcgcgtggtgcgcattccgcaaaatataagcaccgcatttagtggtaatatg
gccattggtgccacctacgcagaacatggaacacactttgccactctcagcggagacgta
attgcgaaagagctagcggtactgggctttaatgtgaattttgcaccatcggtagatgtg
aatgtaaacccagagaacccagtgataaacgtacgttcgttcggcgaagatcctcacgtc
gtatctcagttgggcttcgcgcaaatgcaagccatgcaaaataataaggtgattgctgca
ctaaaacattttccaggccacggtgataccagtaccgacagccattcaggcttacccttg
gtagagcatgatttagcccaaataaaagcggtagacctcgccccatttcagtatgccatc
gatcatggtgatcccggcatgatcatgacggcccatattcaatacccagcacttgataac
agcatgttcactgctaccaatggtacaaaaacggtgctaccggccacaatgtcgcgggca
attctaactgacctgttaagagacaaaatgggctttaatggtgtaatcattaccgatgcg
ctggatatggccgccatcgcgcacttttatgaacccacagaagcggtgctacaaacattt
aaagcaggcacagacgtcgctctaatgccgttagccatccgcacggcacaagacatacct
aaacttaaaaagatgattaaagatttagcctatagcgtgcaaacaggtgaattatcatta
gcagaagtagagcagtcagtcgcgcgtattaataccttaaaacagcgctatgttcccact
gaaaaagaacaacttcctttgtctcaagctctagtaaaggcccgaaaaacactggcttct
ccagcacatttaaaagcagaacaagagctagcgaacagtgcgatcgtggcgattaaaaac
cagcaagcatggccgataaaaccagccaccaaaatcattcagttagtgatgcctgataac
agcaaatgcatggcaatgaccactgcgctagatgatgcactaaaagcgactccctcaaca
actgatgttgctattcgctgtgccagtcttgttagcgacacaacacagcacattattgcg
caacaacgcaccgcgcaactggttatttttagtgatatcactccgcaacaaagcttggta
gagatgggcggcatggatgacattaccgattggcgcctacggccgaaaaaagaagccttg
gacgcaaaactagtgtcattaatgaaagaggtaaaaccccatcaaatatcgttactgatt
agcatgcgcaccccctatgcagtcgtcgattacgcggattaccttgatggcatcttggca
agttttgcctataacacacaagtcacagagcaagtcgatgcgagtgggcaagcaacgtta
tattatgacggtccaatctatcgcgcgttagccaatatactggtgggtaatcaacgagca
acaggtgctctgcctgttagtatcgataaagtgaacgattaa

DBGET integrated database retrieval system