KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_4098Help
Entry
Glaag_4098        CDS       T01483                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Glaag_4098
Enzymes [BR:gag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Glaag_4098
Exosome [BR:gag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Glaag_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4850362..4851363
Genome map
AA seq 333 aa AA seqDB search
MAEHFPNTRMRRMRRHAFTRDLMAESQLTPKDLIYPVFILEGKNQREAIESMPGVERLSI
DLLIEEAKELHALGIPAMALFPVTPSERKSECASEAFNPDGLAQQAVRALKASVPEMGII
TDVALDPFTSHGQDGLLNEEGYVQNDETIEVLIKQALSHAQAGADIVAPSDMMDGRIGAI
RQALESHGYINTCIMAYSAKYASHYYGPFRDAVGSAGNIKGGNKKSYQMDPANSNEAVRE
IALDIAEGADMVMVKPGMPYLDIVRRCKDEFSVPTFAYQVSGEYAMHKAAFMQGWLEEDA
VILESLLAFKRAGADGILTYFAKQAAQILARDK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacattttcccaacacgcgaatgcgccgcatgcgacgccacgctttcacccgt
gatctcatggccgagagccaactaacccctaaggatctgatttatcccgttttcatttta
gaaggtaaaaatcagcgcgaagcgattgaatcaatgcctggtgttgaaaggttatcaatc
gatttgctgattgaagaagcaaaggaattacacgccttaggcattccagcgatggcactg
tttccggtgactccatcagagcgtaaatcagagtgtgccagtgaagcgttcaaccctgac
ggcttagctcaacaagcagtacgcgccctaaaagcctccgtgcccgaaatgggcattatt
accgatgtggcactagaccctttcacttcgcacggccaagacggactgttaaatgaagag
ggttatgtacaaaatgatgaaaccattgaagtgttgattaagcaggcgttgtcacatgct
caagcgggagcagacatagttgccccttcagacatgatggacgggcgcattggtgctatt
cgccaagcattagagagccatggctatatcaatacctgcatcatggcctactccgctaaa
tacgcctctcactattacggcccatttcgtgatgcagtcggctctgccggcaatattaaa
ggtggtaacaagaagagttaccaaatggacccagccaattccaacgaagccgtgcgtgaa
atcgccttagatattgccgaaggtgccgatatggtgatggtaaaacctggtatgccctat
ttggacattgttcgtcgttgtaaagacgagttctcggtaccgacgtttgcctatcaagtc
agcggcgagtatgccatgcacaaagcggcattcatgcaaggctggttagaagaagatgca
gtgattttggaatcgctattagcatttaaacgcgcaggagcagacggtattttaacttac
tttgctaaacaggcggcgcagattttagccagagataaataa

DBGET integrated database retrieval system