KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_4107Help
Entry
Glaag_4107        CDS       T01483                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00071  Fatty acid degradation
gag00280  Valine, leucine and isoleucine degradation
gag00281  Geraniol degradation
gag00310  Lysine degradation
gag00362  Benzoate degradation
gag00380  Tryptophan metabolism
gag00410  beta-Alanine metabolism
gag00640  Propanoate metabolism
gag00650  Butanoate metabolism
gag00903  Limonene and pinene degradation
gag00930  Caprolactam degradation
gag01040  Biosynthesis of unsaturated fatty acids
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
gag01212  Fatty acid metabolism
Module
gag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Glaag_4107
   00650 Butanoate metabolism
    Glaag_4107
  Lipid metabolism
   00071 Fatty acid degradation
    Glaag_4107
   01040 Biosynthesis of unsaturated fatty acids
    Glaag_4107
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Glaag_4107
   00310 Lysine degradation
    Glaag_4107
   00380 Tryptophan metabolism
    Glaag_4107
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Glaag_4107
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Glaag_4107
   00281 Geraniol degradation
    Glaag_4107
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Glaag_4107
   00930 Caprolactam degradation
    Glaag_4107
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Glaag_4107
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Glaag_4107
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Glaag_4107
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Glaag_4107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEE25031
UniProt: F4AMJ4
Position
complement(4860787..4862946)
Genome map
AA seq 719 aa AA seqDB search
MIYEGKSLNVTLLPNGIAELVFDAQGSVNKFDRQTVSELDEATQALKSQSDVKGVLVRSN
KSTFIVGADITEFTGLFDMPAEEVLTWVAKTSQVFDRFEDLPFPTISAINGFALGGGCEM
TLACDLRVADTTAAIGLPEVKLGLMPGFGGTVRLPRLIGADNALEWMTTGRDRKAAKALA
EGAVDAVVAPEKLRDAALSMLQDAIDGKFGWQARRAQKQAPLKLNKNESMMSFSTAKAMV
FAQAGKHYPAPHAMVDTVANAARLDRAGALELENQGFTQLAKSDAAKAQVGIFLADQLVK
SKGKKQAKAATKDVKQTAVLGAGIMGGGIAYQSAVKGTPVIMKDINQGALDLGLNEAAKI
LGKGMQRGKVTPAVMASTLNNIVPTLEYSAIKDVDLVIEAVVENPKVKGIVLKETEQNVS
DDTVICSNTSTISINQLAESLEKPERFCGMHFFNPVHKMPLVEIIRGEKTTDATIATVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLVMDGADFVAVDKVMEKIFGWPMGPAY
LLDVVGMDTADHASSVMADGIPERMQKIENDPVTLLYKSERLGQKNGKGFYNFSVDKRGR
PAKKAADEAYELFAPHCADKRDFEADEIIARVMIPMANEAIRCLEEGIVGSAAEADMALL
YGLGFPPFRGGVFRYIETMGLANFVALADKYADLGPIYRISDGVREMAASGKSYFSQSA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaggcaaaagcctcaacgtaacgctgttgccaaacggcattgcagagctt
gtattcgatgctcaaggttcggtgaataaatttgatcgtcaaacggttagcgaactagat
gaagcaactcaagccctcaaaagtcagtcagacgttaaaggcgtgttggttcgctcgaat
aagtcgacctttatcgtaggggccgatattactgaattcactggcttgttcgatatgcct
gcagaagaagtattaacctgggtagcgaagacgtctcaagtattcgatagattcgaagac
ttacctttcccgaccatttcggctatcaacggtttcgctttaggcggcggttgtgaaatg
accctagcctgtgacttgcgagttgctgacaccacagcagccattggtttaccagaagtt
aaattgggcctaatgcccggttttggtggcactgtacgtttgcctcgcctaatcggtgcc
gataatgccctagagtggatgaccaccggccgtgaccgcaaagccgcgaaagcattagca
gaaggcgcagtggatgctgttgtcgcgcctgaaaaattacgtgatgcagcccttagtatg
ttgcaagacgctattgacggtaagtttggctggcaagcacgtcgcgcgcaaaaacaagcg
ccgcttaagctaaacaaaaatgaatccatgatgagcttctcaacagctaaagccatggtt
tttgctcaagcaggtaagcattacccagcaccacacgctatggttgatacggttgcaaac
gcagcccgtttagaccgcgcgggtgcgcttgaacttgaaaaccaaggttttactcaatta
gccaaaagtgatgcagctaaagctcaagtgggtatcttccttgctgatcagttagtgaaa
agcaaaggtaaaaaacaagccaaggccgcaacgaaagacgtaaaacaaacggctgtttta
ggcgcagggatcatgggtggcggtattgcttatcagtcagctgtgaaaggcacgccagtt
atcatgaaagacatcaaccaaggcgcattggatcttggcttgaatgaagcggcaaaaatt
cttggtaaaggcatgcagcgcggtaaagtgaccccagctgtaatggctagtaccttgaac
aacatcgttccgacccttgaatactcagcgattaaagacgttgatttggtcatcgaagcg
gttgttgaaaacccgaaagtcaaaggcatagtgctgaaagaaacagagcaaaatgtgtct
gatgacacagtgatttgctcaaacacttcgacaatctctattaatcagctcgccgaaagt
ttagaaaaaccagagcgtttctgtggcatgcatttctttaaccctgtgcacaaaatgcct
ttggtggagatcatccgcggcgaaaaaaccactgatgccacgattgcaacagtggtagcg
gcaacgctgaaaatgggtaaaaccccgattgtggttaatgattgcccaggtttcttggta
aaccgtgtgttgttcccttatttcgcgggctttagcaagctagtgatggacggcgctgac
tttgttgcagtagacaaagtgatggagaaaatcttcggttggcctatgggccctgcttac
ctacttgacgtagtaggcatggacacggctgatcacgcatcaagcgtaatggccgatggc
attccagagcgtatgcaaaaaatcgaaaacgaccctgttaccttgttgtataaatctgag
cgtttaggtcagaaaaatggcaaaggtttctacaacttcagtgtcgataaacgtggtcgc
ccggcgaagaaagccgcagatgaagcctacgaattgttcgcaccacattgtgctgacaaa
cgtgacttcgaggcagatgaaatcattgcccgagtgatgatccctatggcgaatgaagcg
attcgttgtttagaagaaggcatagtaggcagtgcagcagaagctgacatggccttgttg
tacggtttaggcttccctccatttagaggcggtgtgttccgttacatcgaaaccatgggc
ttggctaactttgtagcccttgccgacaaatacgcggatttaggtccgatttatcggatt
tctgacggtgtgcgcgaaatggccgcctcaggtaaatcttatttttctcaatcagcctaa

DBGET integrated database retrieval system