KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_4226Help
Entry
Glaag_4226        CDS       T01483                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00330  Arginine and proline metabolism
gag00332  Carbapenem biosynthesis
gag01100  Metabolic pathways
gag01130  Biosynthesis of antibiotics
gag01230  Biosynthesis of amino acids
Module
gag_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gag00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Glaag_4226
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Glaag_4226
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Glaag_4226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEE25149
UniProt: F4AP35
Position
complement(4996428..4997525)
Genome map
AA seq 365 aa AA seqDB search
MSQFTWQRAVIKVGSALIAPDGKACSSQFLLPIAQFIVASRAQGKEVILVSSGSVAAGRG
KIGYKHHPSIAEKQAMAAIGQTQMMANWARLFDFDCGQILLTSDDFHNRTRYVNIKNTLR
ELLRNNALPIVNENDTVVINELKVGDNDNLAAYTALVAQADTLIICSDIDGLYDADPRQN
PNAKFIPRVDEIDHSIHQLAGGAGTSVGTGGMRTKIQAAEKCAKSGIQTLIVNGRNPEVF
EQLALSRQPGTLFVPSKNRDSARTQWLRHTLRSKGTLVIDDGASIALANNGASLLPSGIT
SVLGSFKPGEAVDIRYKDQIIAKGLCLYGNSELSQIKGQRSDKIETILGYSSGEVAVHRD
DLVLL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagttcacgtggcaacgtgccgtcattaaagtcggcagcgccttgatcgcgcca
gatggcaaagcatgcagtagtcagtttttactgcctattgcacagtttattgttgctagc
agggcgcaaggtaaagaagtcattttagtgtcttctggcagtgtggcagccggacgcggt
aaaataggctataagcatcatccctctatcgcggaaaagcaggcaatggccgccattggt
caaacacaaatgatggccaattgggcacgtttgtttgatttcgattgtgggcaaatattg
ctaacgtcagatgattttcataatcgtacacgctacgtaaatattaaaaataccttgcgc
gagctattgcgtaataacgccctgccgatcgtgaacgaaaacgacacagtcgttattaac
gaactaaaagtgggtgataacgataatctcgcagcgtataccgccttggtagcccaagcc
gataccttgattatctgttcggatattgatggtttatatgacgccgacccaaggcaaaat
ccaaacgccaagtttatccctagggtagatgaaatagaccacagtattcatcagttggcg
ggtggtgcaggtaccagtgtaggcaccggcggtatgcgtactaaaattcaagccgccgaa
aaatgcgccaaaagtggtattcaaacccttattgttaatggccgtaaccccgaagtattt
gagcaacttgcgctatccaggcagcccggtaccttgtttgtacctagtaaaaatcgagac
agtgctcgtacccaatggctacgccacacattacgctcaaaaggcactctcgtgatagat
gatggtgcttcgattgcactggcgaacaatggcgcatccttactgccctcaggtattacc
agtgtattaggctcgtttaaaccaggcgaagcagttgatattcgttataaagaccagata
atagctaaaggactttgtttgtacggcaacagtgagttgtcgcaaattaaagggcaacgc
agcgataaaatcgaaaccattcttggttactcatccggcgaggtcgccgtccatcgtgac
gaccttgttttactctag

DBGET integrated database retrieval system