KEGG   Granulosicoccus antarcticus: IMCC3135_11750Help
Entry
IMCC3135_11750    CDS       T04938                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gai  Granulosicoccus antarcticus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:gai00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC3135_11750 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC3135_11750 (phbA)
   00640 Propanoate metabolism
    IMCC3135_11750 (phbA)
   00650 Butanoate metabolism
    IMCC3135_11750 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    IMCC3135_11750 (phbA)
   00072 Synthesis and degradation of ketone bodies
    IMCC3135_11750 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC3135_11750 (phbA)
   00310 Lysine degradation
    IMCC3135_11750 (phbA)
   00380 Tryptophan metabolism
    IMCC3135_11750 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IMCC3135_11750 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC3135_11750 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IMCC3135_11750 (phbA)
Enzymes [BR:gai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IMCC3135_11750 (phbA)
Exosome [BR:gai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IMCC3135_11750 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2661068..2662243
Genome map
AA seq 391 aa AA seqDB search
MNDIVITGAARTPIGSFLGTLSSVSAVDLGATAITEALKRSAVDAADVSEVIFGQVLTAG
AGQNPARQSAMKAGIPAASTAVTVNQVCGSGLRTVAMGFQAIKAGDSQIVVAGGQESMSL
STHCASLRTGQKMGDASFIDTMIKDGLWDAFHGYHMGTTAENVAAKWEITREEQDAFAAK
SQQKAEAAQAAGKFVDEIVPVTVKNRRGDVVVDADEYIKPGTTAETLAKLRPAFSKEGTV
TAGNASGLNDGAAALVLMSSDEAKKRGAKPLARIVSWATAGVEPAVMGSGPIPASRAALE
KAGWSVGDLDLIEANEAFAAQACAVNKELEWDTDKVNVNGGAIALGHPIGASGARVLISL
LHEMQRRDAKKGLVTLCIGGGMGIAMCVERD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatagtcatcactggcgcagccaggactcctatcggctcttttcttggaacc
ttgtccagcgtatcggctgtcgatcttggggccacggccatcacagaagcgttgaagcgc
agtgcggttgatgctgccgatgtctcggaagtgattttcggacaggttctcacggcaggt
gccggtcagaacccagctcgtcaatctgccatgaaagcaggaattcctgcggcaagcacg
gcagttacagtcaatcaggtttgtggctccggactgcgtacagttgccatgggctttcaa
gctatcaaagcgggcgacagtcaaatcgtcgttgctggcggacaggaaagcatgagtctg
tcgactcactgcgcgtcattgagaactggccagaagatgggtgatgcgagtttcattgac
accatgatcaaagatggtttgtgggatgcttttcacggctaccacatgggaacaactgca
gagaacgtcgcagccaaatgggaaattactcgtgaagagcaggacgctttcgcagccaag
tctcagcaaaaagctgaagctgctcaggcagcgggcaagttcgtcgacgaaatcgtaccc
gttactgtcaagaaccgtcgtggtgacgtggtggttgatgcagacgaatacatcaagcct
ggaactactgctgaaacattggcaaagctgcgtccagcgttctcgaaggaaggcactgta
acggcaggtaatgcatcaggactcaacgatggtgctgcagcattggtactcatgagttcc
gatgaagcgaaaaaacgtggtgctaagccacttgcacgtatcgttagctgggccactgcc
ggtgttgagcctgcagtcatgggttcagggcctattcctgccagtcgtgcagcgcttgag
aaggctggctggtcagtcggtgatctggacttgatagaagccaacgaagcattcgctgca
caggcctgtgcagttaataaagagctggagtgggataccgacaaagtgaacgtcaacggt
ggagccattgcactgggacatccgattggagcctctggtgcacgtgtactgatatctttg
ctgcacgaaatgcagcgacgtgatgctaaaaagggacttgttacactttgcatcggtggc
ggtatgggaatcgccatgtgtgttgagcgggattaa

DBGET integrated database retrieval system