KEGG   Gallibacterium anatis: UMN179_00016Help
Entry
UMN179_00016      CDS       T01482                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gan  Gallibacterium anatis
Pathway
gan00260  Glycine, serine and threonine metabolism
gan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gan01100  Metabolic pathways
gan01110  Biosynthesis of secondary metabolites
gan01130  Biosynthesis of antibiotics
gan01230  Biosynthesis of amino acids
Module
gan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMN179_00016
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMN179_00016
Enzymes [BR:gan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UMN179_00016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEC16053
UniProt: F4H9N9
Position
complement(13164..13976)
Genome map
AA seq 270 aa AA seqDB search
MSRFDQLFEKLNQQKRGAFVPFVTLCDPTLDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALSAGFSTDACFELLEKVRQKYPQIPVSLLLCANLIYAKTLDGFYQCCQQ
VGVDAVLVADMPLLAAEPYVTTAKKYGIQPVFICPPNASEKTIEGVAKNSEGYTYLVSRA
GVTSAENQAHASNLDDLISRLKSHNAPPILQGFGIAKPEQVREAISSGTDGAISGSAVVK
IIERNLDNQTQCLAELAEFVRNMKAATALA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgatcaactttttgaaaaattaaatcaacagaaacgaggtgcattcgtt
cctttcgtgacactttgcgatccaacattagatcgctcttttgagattatttgtacttta
gtggataacggtgccgatgctttagaattaggttttcctttctccgatcctttattagac
gggccggtcattcaagcggcaaataacagagctttatctgccggtttcagcaccgatgcc
tgttttgaattgttagaaaaagtgcgccaaaaatatccgcaaattccagttagcctattg
ctttgtgccaatttaatttatgccaaaacattggatggattttatcagtgttgccaacaa
gttggcgttgatgcggtattggttgccgatatgcctctacttgctgcagaaccttatgtt
accacagcgaaaaaatatggcatccaaccggtctttatctgcccaccgaatgccagcgaa
aaaacgattgagggggtagcgaaaaacagtgaaggatatacttatcttgtatctcgtgcc
ggcgtgaccagtgctgaaaatcaagcgcacgcaagcaatttggacgatctgatttctcgc
ttaaaatcacataatgcaccgcctattttgcaaggttttggtattgctaagccggaacag
gttcgtgaagcaatttcatccggcacagatggtgcaatttctggttcggcagtggttaaa
attatcgaacgtaaccttgataatcagacacaatgccttgctgaattagctgaatttgtg
cgcaatatgaaagctgcaactgcgcttgcataa

DBGET integrated database retrieval system