KEGG   Gallibacterium anatis: UMN179_00017Help
Entry
UMN179_00017      CDS       T01482                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gan  Gallibacterium anatis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UMN179_00017
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMN179_00017
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UMN179_00017
Enzymes [BR:gan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UMN179_00017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(13976..15172)
Genome map
AA seq 398 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLQQLEKAFVEARQDPEFQKQFNDLLQNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAMRMGKSEIIAETGAGQHGVAT
ALACAMLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVISVNKGSCSLKDACCEAMRDWSA
NYDKAHYLLGTAAGPHPFPTIVRELQKMIGEETKRQVFEREGRLPDAVIACVGGGSNSIG
MFADFIKEESVKLIGVEPAGKGIETGQHGAPLGHGSVGIYFGMKSPLMQTKDGQIEESYS
ISAGLDFPSVGPQHAYLNSIGRAQYVSITDDEALDAFQQLAQHEGIIPALESSHALAYAL
KLIKQHPEQEQLLVVNLSGRGDKDIFTVDKILKAKGAK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattattaaacccttatttcggcgagttcggcggaatgtatgtgccggag
attcttgttccggtgttgcaacagctggagaaagcctttgttgaggcacgtcaagatccg
gaatttcaaaaacaatttaacgatttattgcagaattatgccggtcgtccgaccgcatta
actttatgccgtaacttaacaaaaggaactaaaaccaaactttatttaaaacgtgaagat
cttttgcacggcggtgcgcacaaaactaatcaggtgctaggtcaggcacttttggcaatg
cgaatgggtaaaagcgagattattgctgaaaccggtgcaggtcagcacggtgtcgccact
gctctagcctgtgcgatgctcggattaaaatgtcgtatctatatgggcgcaaaagatgtt
gaacgtcaatcaccaaatgttttcagaatgcgccttatgggagcagaagtgatttccgtt
aataaaggttcctgttcattaaaagatgcttgctgcgaagcaatgcgcgattggtcagcc
aattatgataaagcacactatttattaggcactgcagccggtccacacccattcccgact
attgtacgtgaactccaaaaaatgatcggggaagaaactaaacgccaagtttttgaacgt
gaaggacgcttaccggacgcagtgattgcgtgtgtcggtggtggttcaaactcaatcgga
atgtttgctgattttattaaagaagaatccgtaaaactcatcggcgttgagccggcaggt
aaaggcattgagaccggacaacacggtgcgccgcttggacacggttctgtcggtatttat
ttcgggatgaaatcaccattaatgcaaaccaaagatgggcagatcgaagaatcttactcc
atttccgccggattggacttcccttctgttgggccgcaacacgcctatttgaacagtatc
ggtcgtgcgcaatatgtttccattactgatgatgaagcccttgatgcattccaacaattg
gcacaacacgaaggcattattccagcattggaatcctcccacgccttagcttatgcttta
aaattgataaaacagcatccggaacaagaacagcttttggtggtgaatctgtccggacgt
ggtgataaagatattttcacagtagataaaatcctaaaggcaaaaggagcaaaataa

DBGET integrated database retrieval system